KEGG   Mus musculus (mouse): 20135
Entry
20135             CDS       T01002                                 

Gene name
Rrm2, AA407299, R, R2
Definition
(RefSeq) ribonucleotide reductase M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00240  Pyrimidine metabolism
mmu00480  Glutathione metabolism
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu04115  p53 signaling pathway
Module
mmu_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP => dCTP
mmu_M00938  Pyrimidine deoxyribonuleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    20135 (Rrm2)
   00240 Pyrimidine metabolism
    20135 (Rrm2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    20135 (Rrm2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    20135 (Rrm2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    20135 (Rrm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    20135 (Rrm2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     20135 (Rrm2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    20135 (Rrm2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 20135
NCBI-ProteinID: NP_033130
MGI: 98181
Ensembl: ENSMUSG00000020649
Vega: OTTMUSG00000027512
UniProt: P11157
Structure
PDB: 
1W69 1XSM 1W68 1H0N 1H0O

Position
12 A1.3; 12 8.5 cM
AA seq 390 aa
MLSVRTPLATIADQQQLQLSPLKRLTLADKENTPPTLSSTRVLASKAARRIFQDSAELES
KAPTNPSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEAL
KPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLL
IDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGS
FASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPAEQRVREIITNAVRI
EQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFRVENPFDFMENISLEGKT
NFFEKRVGEYQRMGVMSNSTENSFTLDADF
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgctctccgtccgcaccccgctcgccaccatcgctgaccagcagcagctgcagttgtcg
ccgctgaagcgactcaccctggctgacaaggagaacacgcccccgactctcagcagcacc
cgcgtcctggccagcaaagctgcgaggagaatcttccaggactccgccgagctggaaagt
aaagcgcctactaaccccagcgttgaggatgagccgttactgagagaaaacccccgccgc
ttcgttgtctttcccatcgagtaccatgatatctggcagatgtacaagaaagccgaggcc
tccttttggactgccgaggaggtggacctttccaaggatattcagcactgggaagctctg
aaacccgatgagagacattttatatctcacgttctggctttctttgcagcgagtgatggc
atagtcaatgagaacttggtggagcgatttagccaagaagttcaagttacagaggcccgc
tgtttctatggcttccaaattgccatggaaaacatacactctgaaatgtacagtctcctt
attgacacttacattaaagatcccaaggaaagagaatatctcttcaatgctattgaaaca
atgccttgtgtgaagaagaaggctgactgggccttgcgctggattggggacaaagaggct
acgtatggagaacgcgttgtggcctttgccgccgtagaaggaatcttcttttccggttct
tttgcatcgatattctggctcaagaaacgggggctgatgccgggccttacattttccaat
gagcttattagcagagacgagggtttacactgtgactttgcctgcctgatgttcaagcac
ctggtacacaagccagcagagcagagggtccgagagataatcaccaacgccgttaggata
gagcaggagttcctcacggaggccttgcccgtgaagctcatcgggatgaactgcactttg
atgaagcagtacattgagtttgtggccgacaggcttatgctggagctgggttttaacaag
attttcagagtagaaaatccgtttgacttcatggaaaatatctcactagaaggaaagaca
aacttctttgagaagcgagtaggcgagtatcagaggatgggagtcatgtcgaattcgaca
gagaactcttttaccttggatgctgacttctaa

DBGET integrated database retrieval system