KEGG   Mus musculus (mouse): 20148Help
Entry
20148             CDS       T01002                                 

Gene name
Dhrs3, Rsdr1, retSDR1
Definition
(RefSeq) dehydrogenase/reductase (SDR family) member 3
  KO
K11146  short-chain dehydrogenase/reductase 3 [EC:1.1.1.300]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    20148 (Dhrs3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     20148 (Dhrs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 Epimerase Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 20148
NCBI-ProteinID: NP_035433
MGI: 1315215
Ensembl: ENSMUSG00000066026
Vega: OTTMUSG00000010749
UniProt: O88876
Position
4; 4 E1
AA seq 302 aa AA seqDB search
MVWKWLGALVVFPLQMIYLVTKAAVGMVLPPKLRDLSRESVLITGGGRGIGRHLAREFAE
RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQMAKAVREKVGDITIL
VNNAAVVHGKSLMDSDDDALLKSQHVNTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS
AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP
LKPETVARRTVDAVQQNQALLLLPWTMNILIILKSILPQAALEEIHRFSGTYTCMNTFKG
RT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggtgtggaaatggctgggcgcgctggtagtgttccctctgcaaatgatctatttggta
accaaagcagccgtgggaatggtgttgccccccaagcttcgggacttgtcgcgggagtca
gtcctcatcaccggcggtgggagaggcatcggacgccacctcgctcgggagttcgcagag
cgtggcgccagaaagattgttctctgggggcggactgaaaaatgcctcaaggagacgaca
gaggagattcggcagatgggcacagagtgccactacttcatctgtgacgtgggcaaccgg
gaagaggtgtaccagatggccaaagctgtccgagagaaggtgggtgacatcaccatcctg
gtgaacaatgccgctgtggtccatggaaaaagcttgatggacagtgacgatgatgccctc
ctcaagtcccagcatgtcaacaccctgggccaattctggaccaccaaggcctttttgcca
cgtatgctggaactccagaacggccatattgtgtgcctcaattccgtgcttgcactgtca
gccatccctggcgccatcgactactgcacgtcaaaagcatcagccttcgccttcatggag
agcctgaccttggggctgttggactgtcctggtgtcagcgccaccaccgttctgcccttt
cacaccagcaccgagatgttccagggcatgagagtcaggtttcccaacctcttcccgcca
ctgaagccagagacagtagcccggaggacggtagatgctgtgcaacaaaaccaggccctt
ctcttgctcccgtggaccatgaatatcctcattatcttgaaaagcatactcccacaagct
gcactggaggagattcacaggttctcggggacttacacctgtatgaacacctttaagggg
aggacatag

DBGET integrated database retrieval system