KEGG   Mus musculus (mouse): 20167
Entry
20167             CDS       T01002                                 

Gene name
Rtn2, MMS10-P, Ms10p, N, NSPLI, Nspl1
Definition
(RefSeq) reticulon 2 (Z-band associated protein)
  KO
K20722  reticulon-2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20167 (Rtn2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    20167 (Rtn2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    20167 (Rtn2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    20167 (Rtn2)
SSDB
Motif
Pfam: Reticulon mono-CXXC
Other DBs
NCBI-GeneID: 20167
NCBI-ProteinID: NP_038676
MGI: 107612
Ensembl: ENSMUSG00000030401
Vega: OTTMUSG00000058967
UniProt: O70622 Q6IM75
Position
7 A3; 7 9.54 cM
AA seq 471 aa
MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEDEEEETTSQDWGTPR
ELTFSYIAFDGVVGSGGRRDSVVRRPRPQGRSVSEPRDPPQQSGLGDSLESIPSLSQSPE
PGRRGDPDPVPPAERPLEELRLRLDQLGWVVRSAGSGEDSATSSSTPLENEEPDGLEASE
AGEETNLELRLAQSLHLQLEVLTPQLSPSSGTPQAHTPSPQRSQDSNSGPDDEPLLNVVE
EHWRLLEQEPITAQCLDSTDQSEFMLEPLLLVADLLYWKDTRTSGAVFTGLMASLLCLLH
FSIVSVAAHLALLGLCATISLRVYRKVLQAVHRGDGTNPFQAYLDMDLTLTREQTERLSQ
QIASHVVSTATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLVILGVVALFTVPL
LYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGTLAPTASVSGSKAKAE
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggggcaggtcctgccggtcttcgcccactgcaaagaagctccatctacagcctcttct
acccccgattccacggaaggagggaatgacgactcagattttcgggagctgcacacagcc
cgggaattctcagaggatgaagaggaggagaccacatcgcaggactggggcacccccagg
gagctgaccttttcctacattgccttcgacggcgtggtgggctctgggggccgtagggac
tcagttgttcgtcgtccccggccccagggacgttcagtctcagaaccacgggacccaccc
caacagtccggcctgggtgacagcttggaaagcatccctagcctgagccagtccccagag
ccagggcgccgcggtgaccctgaccccgtgcctccagctgagcgcccgctggaggaactg
aggctgcggctggaccagcttggctgggttgtccggagtgcgggatctggggaggattcg
gccaccagcagctccacccctctggaaaatgaggagcctgatggattggaggccagcgag
gctggagaagagacgaatctggaactccgacttgctcagtctctacatttgcaacttgag
gtcctgactcctcaacttagccctagctccgggaccccccaggcgcatactccatcccca
caaagatctcaagattcgaactccggtcctgatgatgagcctctgctgaatgtggtagaa
gagcattggcggctgctggagcaggagccaatcacggcccagtgcctcgatagcacagac
caatcagaattcatgttggagccgctccttctagtggcagacctgttgtactggaaggac
accaggacgtcgggagcggtcttcacgggcctcatggcctctctcctctgcctcctgcac
tttagcatcgtgtccgtggctgcgcacctggccctgttgggtctctgcgccaccatctct
ctcagggtttaccgcaaagtgctgcaggccgtgcaccggggcgacggcaccaaccctttc
caggcctacctggacatggacctgaccctgactcgggagcagacagaacgtttgtcccag
cagatcgcctcccacgtggtctccacagccacacagctacggcatttcttcctagtggaa
gacctggtggattctctcaagctggctcttctcttctacatcttgacctttgtgggagcc
atcttcaacggcttgactcttgtcatcctaggagtggttgctttgtttaccgtccccctt
ctgtacagacaacatcaggcccagattgaccagtatgtggggttggtgaccaatcagttg
agccacatcaaagctaagatccgagctaagatcccggggaccggaacccttgccccaaca
gcatcagtctccggatccaaagccaaagccgaatga

DBGET integrated database retrieval system