KEGG   Mus musculus (mouse): 20168
Entry
20168             CDS       T01002                                 

Gene name
Rtn3, RTN3-A1
Definition
(RefSeq) reticulon 3
  KO
K20723  reticulon-3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    20168 (Rtn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20168 (Rtn3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    20168 (Rtn3)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    20168 (Rtn3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    20168 (Rtn3)
SSDB
Motif
Pfam: Reticulon
Other DBs
NCBI-GeneID: 20168
NCBI-ProteinID: NP_001003934
MGI: 1339970
Ensembl: ENSMUSG00000024758
UniProt: Q9ES97
Position
19; 19 A
AA seq 964 aa
MAESSAATQSPSVSSSSSGAEPSALGGGGGSPGACPALGAKSCGSSCADSFVSSSSSQPV
SIFSTSQAGLSSLCSDEPPSKSMTSSFLSSSEIHNPDPTTPLGEKSETLGSQFVLAKGKD
PLVLLDKKKLDSPQGTNKDRVDAPVSLATGIPCSHPSIPDSFPEQPAFLSKEIGPAEEWV
VKDQEPKNPNKVPDGEDRSALDFGQSKAEHICTYSLSPSELPVASVEKDSPESPFEVIID
KATFDREFKDLYKENPNDLGGWAAHGDRESPADLLEMNDKLFPLRNKEAGRYPSSVLLGR
QFSHTTAALEEVSRCVNDMHNFTNEILTWDLDPQAKQQANKTSCTTESTGLDRSELRSEI
PVINLKTNPQQKMPVCSFNGSTPITKSTGDWTEAFTEGKPVRDYLSSTKEAGGNGVPGSS
QLHSELPGSMPEKWVSGSGAATVEVTLPNLRGAWPNSVMGEVTEVDSSGESDDTVIEDIT
EKPDSLPSAAAKTSEREIKETPSRETVRSEMCENSEQPQAQPETPTQKSLEGEVASQVPN
TLNEVTPEKLDMTNNPKVCSAAPPSVLNETGFSLTVPASAKLESLLGKYVEDTDGSSPED
LMAVLTGAEEKGIVDKEEGDVLEAVLEKIADFKNTLPVELLHESELSGSETKNIKSKYSE
DSRETTGGAPTMSPDLEQEQLTIRAIKELGERQAEKVQDEGISSGGKLKQTFAPQSGPQS
SSDILEHTDVKTGSDLGIPKNPTIIKNTRIDSISSLTKTEMVNKNVLARLLSDFPVHDLI
FWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEE
GHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMT
YVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAK
KKAE
NT seq 2895 nt   +upstreamnt  +downstreamnt
atggcggagtcgtcagcggccactcagtccccgtcagtctcctcgtcgtcctccggggcc
gagccgtcagctctcggcggcggcggcgggagccctggagcctgccccgccctgggggcg
aagagctgcggctcctcgtgtgcggattcctttgtttcttcctcttcctctcagcctgta
tctatattttcgacctcacaagcgggattgagctctctttgctctgatgagccaccttca
aaaagtatgacttcctcctttctttcatcttctgaaatacataaccctgaccctacaaca
ccgcttggagaaaagagtgaaacattaggtagccagtttgttctagctaaaggaaaagac
cccttggttcttctagataagaaaaaactggactcacctcaggggaccaacaaggacaga
gtagacgctccggtttctcttgcaactggcattccttgcagccacccttctattccagac
agtttcccagagcaacctgcttttctgtcaaaagaaattggtccagcagaagagtgggta
gttaaagaccaagaacccaagaacccaaacaaggttccagatggggaggacagaagtgca
ctggattttgggcagtctaaggcagaacacatttgtacatattccttgtccccatctgaa
cttccagtagccagtgtagaaaaagattctcctgagtcaccgtttgaagtaattattgac
aaagcaacatttgacagagaatttaaagatttgtataaggaaaacccaaatgatttgggt
ggctgggcagctcatggcgatagagaatcccccgcagacttgttggaaatgaatgacaaa
ctctttccactgagaaataaagaggcagggcgttacccatcctctgtactgctcggtaga
cagttctcacacactacagcagcactggaagaggtgtctagatgtgtgaatgatatgcat
aactttactaatgaaatactgacttgggacttagatccccaagcaaaacaacaggccaat
aaaacatcttgcaccacagaaagtacaggactagacaggagtgaacttcgctcagaaatt
ccagttataaatcttaaaacaaaccctcaacagaaaatgcctgtatgttcttttaatggg
agcactcccattaccaaatccacaggtgactggacagaagcatttacagaaggaaaacct
gtaagagactacctcagttccacaaaagaagctggtggcaacggtgtgccaggcagttct
cagcttcattctgagctgcctggctctatgcctgagaaatgggtctcaggctctggagca
gccacagtggaagtaactttacctaacctgaggggtgcctggcctaactctgtgatgggg
gaagtcacagaggttgatagttctggggaatctgatgacacagtaatagaggacatcaca
gaaaaacctgactcccttccaagtgctgctgcaaaaacaagtgaaagggaaatcaaagag
actcccagtcgtgaaactgtgaggagtgaaatgtgtgaaaactctgagcagccgcaggcc
cagccagaaactcctactcagaagagtctggaaggtgaggtggcttcacaagtacctaat
accctgaatgaagtcacacctgaaaagcttgatatgactaacaaccccaaagtttgctca
gcagcacctccaagtgttcttaatgagacaggattctcactaactgtgccagcttctgcc
aagttggaatctttgcttggaaaatatgttgaagatacagatggttcctccccagaggac
ttgatggctgtcctcacaggagccgaggagaaggggatagtggataaagaggaaggtgat
gttttggaagcagtgttagagaagatagcagactttaaaaacactttgcctgtggaactc
ttgcatgaaagtgagctaagtggttctgaaaccaaaaatattaaaagcaaatacagtgaa
gacagcagagaaacaactggaggtgcccctacgatgtctcccgacttagagcaggagcag
ctcaccatcagagccattaaagaattaggagaaaggcaagctgagaaggtgcaggatgaa
ggaatatcttctggaggaaaactcaagcaaacctttgctccacagtctgggccacagagt
tcatctgacatcctagaacacacagatgtcaaaactggatctgatcttggaattcccaaa
aatcctactatcatcaaaaacactagaatagattctatttccagccttaccaagactgaa
atggttaacaagaatgttctagcaagacttctcagtgatttcccagtgcacgatctgatt
ttctggcgagatgtgaagaagactgggtttgtctttggcaccacactgatcatgctgctc
tctctggcagccttcagtgttatcagtgtggtctcttacctcatcctggctcttctctct
gtcaccatcagcttcagagtctataagtctgtcattcaagctgtgcagaagtcagaagaa
ggacatccattcaaggcctacttggatgtggacattaccctgtcttcagaagctttccac
aactacatgaatgctgcgatggtgcatgtcaacaaggccctcaaactcattattcgtctc
tttctggtagaagacttggttgactccttgaagctggctgtcttcatgtggctgatgacc
tatgttggtgctgtttttaatggaattacccttctgattctcgccgagctgcttgtcttc
agcgtcccaattgtctatgagaagtataagacacagattgaccactatgttgggattgcc
cgggatcagaccaagtcaattgttgaaaagatccaagcaaagcttcctggaatcgccaaa
aaaaaggcagaataa

KEGG   Mus musculus (mouse): 68585
Entry
68585             CDS       T01002                                 

Gene name
Rtn4, 1110020G17Rik, AA407876, AA409940, AA960376, ASY, C130026I10Rik, N, NOGO, NSP-CL, NgA, No, Nog, Nogo-A, Nogo-B, Nogo-C, mKIAA0886, mKIAA4153
Definition
(RefSeq) reticulon 4
  KO
K20720  reticulon-4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68585 (Rtn4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68585 (Rtn4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    68585 (Rtn4)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    68585 (Rtn4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    68585 (Rtn4)
SSDB
Motif
Pfam: Reticulon DUF639
Other DBs
NCBI-GeneID: 68585
NCBI-ProteinID: NP_918943
MGI: 1915835
Ensembl: ENSMUSG00000020458
Vega: OTTMUSG00000005336
UniProt: Q99P72
Structure
PDB: 
2KO2

Position
11; 11 A3.3
AA seq 1162 aa
MEDIDQSSLVSSSADSPPRPPPAFKYQFVTEPEDEEDEEDEEEEEDDEDLEELEVLERKP
AAGLSAAPVPPAAAPLLDFSSDSVPPAPRGPLPAAPPTAPERQPSWERSPAASAPSLPPA
AAVLPSKLPEDDEPPARPPAPAGASPLAEPAAPPSTPAAPKRRGSGSVDETLFALPAASE
PVIPSSAEKIMDLKEQPGNTVSSGQEDFPSVLFETAASLPSLSPLSTVSFKEHGYLGNLS
AVASTEGTIEETLNEASRELPERATNPFVNRESAEFSVLEYSEMGSSFNGSPKGESAMLV
ENTKEEVIVRSKDKEDLVCSAALHNPQESPATLTKVVKEDGVMSPEKTMDIFNEMKMSVV
APVREEYADFKPFEQAWEVKDTYEGSRDVLAARANMESKVDKKCFEDSLEQKGHGKDSES
RNENASFPRTPELVKDGSRAYITCDSFSSATESTAANIFPVLEDHTSENKTDEKKIEERK
AQIITEKTSPKTSNPFLVAIHDSEADYVTTDNLSKVTEAVVATMPEGLTPDLVQEACESE
LNEATGTKIAYETKVDLVQTSEAIQESIYPTAQLCPSFEEAEATPSPVLPDIVMEAPLNS
LLPSTGASVAQPSASPLEVPSPVSYDGIKLEPENPPPYEEAMSVALKTSDSKEEIKEPES
FNAAAQEAEAPYISIACDLIKETKLSTEPSPEFSNYSEIAKFEKSVPDHCELVDDSSPES
EPVDLFSDDSIPEVPQTQEEAVMLMKESLTEVSETVTQHKHKERLSASPQEVGKPYLESF
QPNLHITKDAASNEIPTLTKKETISLQMEEFNTAIYSNDDLLSSKEDKMKESETFSDSSP
IEIIDEFPTFVSAKDDSPKEYTDLEVSNKSEIANVQSGANSLPCSELPCDLSFKNTYPKD
EAHVSDEFSKSRSSVSKVPLLLPNVSALESQIEMGNIVKPKVLTKEAEEKLPSDTEKEDR
SLTAVLSAELNKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSV
TISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLF
LVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLAN
KSVKDAMAKIQAKIPGLKRKAE
NT seq 3489 nt   +upstreamnt  +downstreamnt
atggaagacatagaccagtcgtcgctggtctcctcgtccgcggatagcccgccccggccc
ccgcccgctttcaagtaccagttcgtgacggagcccgaggacgaggaggacgaggaagac
gaggaggaggaggaggacgacgaggacctggaggaattggaggtgctggagaggaagccc
gcagccgggctgtccgcggctccggtgccccccgccgccgcaccgctgctggacttcagc
agcgactcggtgccccccgcgccccgcgggccgctgccggccgcgccccccaccgcccct
gagaggcagccgtcctgggaacgcagccccgcggcgtccgcgccatccctgccgcccgct
gccgcagtcctgccctccaagctcccggaggacgacgagcctccagcgcggcctccggcg
ccagccggcgcgagccccctagcggagcccgccgcgcccccttccacgccggccgcgccc
aagcgcaggggctcgggctcagtggatgagaccctttttgctcttcctgctgcatctgag
cctgtgataccctcctctgcagaaaaaattatggatttgaaggagcagccaggtaacact
gtttcgtctggtcaagaggatttcccatctgtcctgtttgaaactgctgcctctcttcct
tctctatctcctctctcaactgtttcttttaaagaacacggataccttggtaacttatca
gcagtggcatccacagaaggaactattgaagaaactttaaatgaagcttctagagaattg
ccagagagggcaacaaatccatttgtaaatagagagtcagcagagttttcagtattagaa
tactcagaaatgggatcatctttcaatggctccccaaaaggagagtcagccatgttagta
gaaaacactaaggaagaagtaattgtgaggagtaaagacaaagaggatttagtttgtagt
gcagcccttcataatccacaagagtcacctgcgacccttactaaagtggttaaagaagac
ggagttatgtctccagaaaagacaatggacatttttaatgaaatgaaaatgtcagtggta
gcacctgtgagggaagagtatgcagattttaagccatttgaacaagcatgggaagtgaaa
gatacttatgagggaagtagggatgtgctggctgctagagctaatatggaaagtaaagtg
gacaaaaaatgctttgaagatagcctggagcaaaaaggtcatgggaaggatagtgaaagc
agaaatgagaatgcttctttccccaggaccccagaacttgtgaaggacggctccagagcg
tacatcacctgtgattcctttagctcagcaaccgagagtactgcagcaaacattttccct
gtgctagaagatcacacttcagaaaacaaaacagatgaaaaaaaaatagaagaaaggaag
gcccaaattataacagagaagactagccccaaaacgtcaaatcctttccttgtagcaata
catgattctgaggcagattatgtcacaacagataatttatcaaaggtgactgaggcagta
gtggcaaccatgcctgaaggtctaacgccagatttagttcaggaagcatgtgaaagtgaa
ctgaacgaagccacaggtacaaagattgcttatgaaacaaaagtggacttggtccagaca
tcagaagctatacaagagtcaatttaccccacagcacagctttgcccatcatttgaggaa
gctgaagcaactccgtcaccagttttgcctgatattgttatggaagcgccattaaattct
ctccttccaagcactggtgcttctgtagcgcagcccagtgcatccccactagaagtaccg
tctccagttagttatgacggtataaagcttgagcctgaaaatcccccaccatatgaagaa
gccatgagtgtagcactaaaaacatcggactcaaaggaagaaattaaagagcctgaaagt
tttaatgcagctgctcaggaagcagaagctccttatatatccattgcatgtgatttaatt
aaagaaacaaagctctccactgagccaagtccagagttctctaattattcagaaatagca
aaatttgagaagtcggtgcctgatcactgtgagctcgtggatgattcctcacccgaatct
gaaccagttgacttatttagtgatgattcaattcctgaagtcccacaaacacaagaggag
gctgtgatgctaatgaaggagagtctcactgaagtgtctgagacagtaacacaacacaaa
cataaggagagacttagtgcttcacctcaggaggtaggaaagccatatttagagtctttt
cagcccaatttacatattacaaaagatgctgcatctaatgaaattccaacattgaccaaa
aaggagacaatttctttgcaaatggaagagtttaatactgcaatttattccaatgatgac
ttactttcttctaaggaagacaaaatgaaagaaagtgaaacattttccgattcatctccc
attgagataatagatgagtttcccacatttgtcagtgctaaagatgattctcctaaggag
tacactgacctagaagtatccaacaaaagtgaaattgctaatgtccagagcggggccaat
tcgttgccttgctcagaattgccctgtgacctttctttcaagaatacatatcctaaagat
gaagcacatgtctcagatgaattctccaaaagtaggtccagtgtatctaaggtgccctta
ttgcttccaaatgtttctgctttggaatctcaaatagaaatgggcaacatagttaaaccc
aaagtacttacgaaagaagcagaggaaaaacttccttctgatacagagaaagaggacaga
tccctgacagctgtattgtcagcagagctgaataaaacttcagttgttgacctcctgtac
tggagagacattaagaagactggagtggtgtttggtgccagcttattcctgctgctgtct
ctgacagtgttcagcattgtcagtgtaacggcctacattgccttggccctgctctctgtg
actatcagctttaggatatataagggtgtgatccaagctatccagaaatcagatgaaggc
cacccattcagggcatatttggaatctgaagttgccatatcagaggaattggttcagaaa
tatagtaattctgctcttggtcatgtgaacagcacaataaaagaattgaggcgtctcttc
ttagttgatgatttagttgattccctgaagtttgcagtgttgatgtgggtatttacttac
gttggtgccttgttcaatggtttgacactactgattttagctctgatctcactcttcagt
attcctgttatatatgaacggcatcaggcgcagatagatcattatctaggacttgcaaac
aagagcgttaaggatgccatggccaaaatccaagcaaaaatccctggattgaagcgcaaa
gcagaatga

DBGET integrated database retrieval system