KEGG   Mus musculus (house mouse): 20184
Entry
20184             CDS       T01002                                 
Symbol
Uimc1, 9430016E08Rik, D330018D10Rik, D630032M02Rik, RIP110, Rxrip110
Name
(RefSeq) ubiquitin interaction motif containing 1
  KO
K20775  BRCA1-A complex subunit RAP80
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    20184 (Uimc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    20184 (Uimc1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     20184 (Uimc1)
SSDB
Motif
Pfam: RAP80_UIM UIM Rad50_zn_hook
Other DBs
NCBI-GeneID: 20184
NCBI-ProteinID: NP_035437
MGI: 103185
Ensembl: ENSMUSG00000025878
UniProt: Q5U5Q9 A0A0R4J073
Structure
Position
13:complement(55175693..55248176)
AA seq 727 aa
MPRRKKKIKEASESQNLEKKDLETSSCVSIKKKRRLEDLLIVISDSDGEETKEENGLQKT
KTKQSNRSKCLAKRKVAHMSEEEQFALALKMSEQEAREVNNQEEKEEELLRKAIAESLNS
CWSSAASATRSRPLAAELSSHSHQENTKDSGTTEGVWQLVPPSLCKGSHVSQGNEAEQRK
EPWDHNENTEEEPVSGSSGSWDQSSQPVFENENVKCFDRCTGHLAEHTQCGKPQESTGSG
YAFSKAVQGRGDTSRQCLPIPADTKGLQDTGGTVHYYWGIPFCPAGVDPNQYTNVILCQL
EVYQKSLKMAQRQLVKKRGFGEPVLPRPPFLIQNECGQEDQTSDKNEGISEDMGDEAKEE
RQESRASVWHSETKDFQKSPIKSLKQKLLLEEEPTTSRGQSSQGLFVEETSEEGLKSSEG
DNSVPTTQSIAALTSKRSLVLMPESSAEETTVCPETQLSFLEPLDLNREDSPDSRELPIE
VRMAVGDKQVANREDCMKENPPPAVSSSTRVSCPLCNQDFPPTKIEQHAMYCNGLMEQET
VLTRRRREAKNKSDGRTAAQPALDANRKEKCYLCKSLVPLGEYQCHVEACLQLAKVDRED
GIEGTRRPRVCAPVEGKQQQRLKKSKDKGHSQGRLLSLLEQSEHRTTGVEKKPKYSEVRT
FRMPSPEVEEASCSREMQSTLSQLNLNESPIKSFVPVSEATNCLVDFKEQFAFRSRTKSG
RGRRRKS
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgccacgaaggaagaaaaaaattaaagaggcctctgaaagccagaacttggagaagaag
gatctggaaacaagcagttgtgtcagtataaagaagaagcgtagacttgaggacttactc
atagtgatatccgatagcgatggagaggaaacaaaagaggagaatggattgcagaaaacg
aagacaaaacagtcgaacagatcaaagtgtttggctaaaagaaaagttgcacacatgtca
gaagaagaacaatttgctttggctctcaagatgagtgagcaggaagctagggaggtgaat
aaccaggaggagaaagaagaggagctcttgcggaaagccattgctgaaagcctgaatagt
tgctggtcttctgctgcttctgctaccagatctcgacctctggctgctgaactatcttca
cattcccatcaagagaacaccaaagactctgggaccactgaaggcgtatggcagctggta
cctccatcactgtgtaaaggctcacatgtcagtcagggaaacgaggctgagcaaagaaag
gagccctgggaccacaatgaaaacactgaagaggagccggtctctggcagctcaggaagc
tgggaccagtcaagccagccagtgtttgagaatgagaacgttaaatgttttgacagatgt
actggccacttggctgagcacacacagtgtgggaagccacaggaaagtactgggagtggt
tatgctttttccaaagctgtccagggtaggggggacacgtctaggcaatgccttcctatc
ccagcagacacaaaaggtctccaggacactgggggcactgtgcactactactggggtatt
ccattctgccctgctggagtagatcccaatcaatacaccaatgtcattctctgccagtta
gaggtttatcagaagagcctgaaaatggctcagagacagcttgttaaaaaaagagggttt
ggggaaccagtgttacctagacctccttttctgatccagaatgaatgtggccaagaagat
cagactagtgacaaaaatgaaggcatctcagaagatatgggagatgaagccaaagaggaa
aggcaggaatctagggcatctgtctggcactcagaaaccaaggattttcaaaaaagtcca
attaaaagcttgaaacagaaacttttgttggaggaagaaccaacaaccagtcgtggtcag
tcttcccaaggtctgtttgttgaagaaacctctgaagaaggtctgaagagttctgaagga
gacaactctgtgcccaccacgcaaagcattgcagctttgaccagtaagagaagtttagtt
cttatgccggaaagttctgcagaagaaaccactgtttgccctgagacacagttaagtttc
cttgaaccccttgacctcaatagagaagactctccagatagcagagagctccccattgaa
gtaaggatggcagtgggcgataagcaggttgctaatagggaagattgtatgaaggaaaac
cctcctcctgcagtctcatctagtacccgggtatcctgcccactgtgtaaccaagacttt
cctcccacaaagattgaacagcatgccatgtactgcaatggtctgatggagcaggaaaca
gtgttgactcggagacgaagagaggccaagaacaagagtgacggtcggacagctgcacag
ccggctctggatgccaacaggaaggagaagtgttatctatgtaagtccctggttccactt
ggggagtatcagtgccatgtggaggcctgtctccagcttgcaaaggttgacagagaagat
gggattgaagggacaaggagaccaagggtgtgtgcacctgtggaggggaaacaacagcag
cggctgaagaagtcaaaggacaaaggccatagtcaaggccgactcctcagtctcttggag
cagtctgagcataggaccacaggtgtagagaaaaaacccaagtattcggaagtaagaacc
ttcaggatgccctcaccagaggtggaagaggctagctgcagcagagagatgcagagtacc
ctctcacagctcaacttaaatgagtctcccatcaagtcttttgttcctgtttcagaagct
acaaattgcttagtggactttaaagaacagtttgctttccggtcacgaactaaatcaggc
agaggaaggaggagaaaatcttga

DBGET integrated database retrieval system