KEGG   Mus musculus (mouse): 20190Help
Entry
20190             CDS       T01002                                 

Gene name
Ryr1, AI528790, RYR-1, Ryr, skrr
Definition
(RefSeq) ryanodine receptor 1, skeletal muscle
  KO
K04961  ryanodine receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04730  Long-term depression
mmu04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20190 (Ryr1)
   04020 Calcium signaling pathway
    20190 (Ryr1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    20190 (Ryr1)
  09156 Nervous system
   04730 Long-term depression
    20190 (Ryr1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    20190 (Ryr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    20190 (Ryr1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20190 (Ryr1)
   04040 Ion channels [BR:mmu04040]
    20190 (Ryr1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20190 (Ryr1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   20190 (Ryr1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ryanodine receptor
   20190 (Ryr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_8 EF-hand_7 Serglycin
Motif
Other DBs
NCBI-GeneID: 20190
NCBI-ProteinID: NP_033135
MGI: 99659
Ensembl: ENSMUSG00000030592
Vega: OTTMUSG00000059211
UniProt: E9PZQ0
Position
7 B1; 7 16.94 cM
AA seq 5035 aa AA seqDB search
MGDGGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVP
PDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLS
CLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERY
LHLSTASGELQVDASFMQTLWNMNPICSGCEEGFVTGGHVLRLFHGHMDECLTISPSDSD
DQRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLGLTEDQGL
VVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTY
AAPDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLD
SFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQ
EEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCAL
FSTNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKV
LDVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQY
GKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGL
HLWTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFP
VVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHL
VGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDD
NKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTY
MMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNP
RLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRARIFRAEK
SYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPF
GRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQV
GHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEVAR
MDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLASPGLQPPA
EDEARAAEPDTDYENLRRSAGGWGEAEGGKDGTAKEGTPGGTAQAGVEAQPARAENEKDA
TTEKNKKRGFLFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDDPEIILNTTTYYYSVRV
FAGQEPSCVWVGWVTPDYHQHDMSFDLSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD
FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQ
NVVQFELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRR
AGERLGWAVQCQEPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRSVCALGNN
RVAHALCSHVDQAQLLHALEDARLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLT
PETRAITLFPPGRSAEDGPRRHGLPGVGVTTSLRPPHHFSPPCFVVALPAAGATEAPARL
SPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDED
VKQILKMIEPEVFREEEEVEEEGEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEDAAEEEK
EELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAECYVDKMQGNQRGRYGL
LMKAFTMSAAETARRTREFRSPPQEQINMLLHFKNGADEEECPLPEEIRQELVNFHQDLL
AHCGIQLEGEEEEPEEESTLGSRLMSLLEKVKLVKKTEEKPEEEPAPEEHKPQSLQELVS
HTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISVSSVEDTMSLLECL
GQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGE
SKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAAS
VIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAV
FVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRR
DRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPETHLIQAGKGEALRIRAILRS
LVPLDDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLL
HVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMV
DSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKM
PLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIA
MPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFA
EYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAW
EWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLA
ENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTR
GLKDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFA
KILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGT
DAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQAR
TQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTR
NPYVEKLRPALGECLARLAAAMPVAFLEPELNEYNACSVYTTKSPRERAILGLPNSVEEM
CPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAG
APPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFI
PTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNN
RAHWLTEPNPNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMA
KAGDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKAR
YALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEV
SAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKA
SWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDED
YLYMAYADIMAKSCHLEEGGENGEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAE
MVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQ
TCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNN
DFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSV
AKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELL
DLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAF
QDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPAR
DIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEI
SETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMEMFVSFCEDTIFEMQIAAQISEPEGE
PEEDEDEGAEEAEEGAAGSDGSGSAAAAGVWVWLAATAGRTLRGLSYRSLRRRVRRLRRL
TAREAATAVAALLWALVTRAGGAGAGAAAGALRLLWGSLFGGGLVDSAKKVTVTELLAGM
PDPTGDEVHGQQPSGAGSDAEGEGEGEGEGDAADGAGDEEAAADQAGTGGADGAVAVADG
SPFRPEGAGGLGDMGDTTPVEPPTPEGSPILKRKLGVDGEEEEPPPEPEPEPEPEPEKAD
TENGEKEVPEPPPEPPKKTPPPPPPKKEEAGGAGLEEFWGELEVQRVKFLNYLSRNFYTL
RFLALFLAFAINFILLFYKVSDSPPGEDDIEGSGAGDMSGAGSGDGSGWGSRAGEEVEGD
EDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLE
FDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLG
MDLASLEITAHNERKPDPPPGLLTWIMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLG
HYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKF
YNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFF
FVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEE
HNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
NT seq 15108 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatggaggaggtgaaggcgaggacgaggtccagtttttgcggacggatgatgaa
gtggtcctgcagtgcagcgccacggtgctcaaggaacagctgaagttgtgtctggccgct
gaggggttcggcaaccgcctttgctttctggaacccaccagcaacgcgcagaatgtaccc
cctgatctggccatctgctgcttcatcctggagcagtctctgtcagttcgagccctgcag
gagatgctggccaatactgtggaggccggtgtggagtcatcccagggcgggggacacagg
acactcttgtatggccacgccatcctgctccggcacgcacacagtcgtatgtacctgagt
tgcctcaccacctcccgatccatgactgacaagttggcctttgacgtgggattacaggaa
gacgcaacaggggaggcctgttggtggacgatgcacccagcctcaaagcagaggtctgaa
ggagagaaggttcgagttggggatgaccttatccttgtgagtgtctcctctgagcgatac
ctgcacctgtcaaccgcaagtggggagctccaggttgacgcctcctttatgcagactctg
tggaacatgaatcccatctgctctggctgtgaagaaggctttgtgactggaggccacgtc
ctgcgcctctttcatggacatatggatgaatgtttgaccatctccccttctgacagtgat
gatcaacgcagacttgtctactacgagggagggcctgtgtgcactcatgcccgctcccta
tggaggctagagccgctgagaatcagctggagtggaagccatctccgctggggccagcca
ctaagaatcagacatgtgaccacagggaggtaccttgggctcactgaggaccaaggcctt
gtggtggttgatgccagcaaggcccacaccaaggctacttccttttgcttccgaatctcc
aaggagaagctggatgtggcccccaagagagatgtggagggcatgggtccccctgagatc
aagtatggagagtcgctctgctttgtacagcatgtggcctcaggcctgtggctcacctat
gctgccccagaccctaaggccctgaggcttggggtactcaagaagaaggccatgctgcac
caggaaggtcacatggatgatgcgttgtcactgacgcgatgccagcaggaggagtcccag
gctgcccggatgatatacagcactgccggcctgtacaaccagttcataaagggtctcgat
agcttcagcgggaagccacggggctcggggccaccggctgggtcagcattgcccatcgag
ggcgtcatcctgagcctacaggacctcattggctacttcgagccgccttcagaggagctg
cagcacgaggagaagcagaccaagctgcgcagcctgcgcaaccgacagagcctcttccag
gaggaggggatgctctccctggtcctgaattgcattgaccgcctcaacgtctacaccacc
gctgcccactttgccgagtttgcgggagaggaggcagctgaatcttggaaagagattgtg
aacctgctctatgaacttctagcctctctgatccgtggcaatcgcaccaactgtgcgctc
ttctccacaaacttggattggctggtcagcaagctggatcgtctggaggcctcatctggc
atcctggaggtgttgtactgtgtcctgattgagagtcctgaggtgctgaacatcatccag
gagaaccacatcaagtctatcatctccctcttagacaagcatgggcggaatcacaaggtc
ctggatgtgctgtgctcactctgtgtgtgcaatggtgtggctgtacgctccaaccaggac
ctcatcaccgagaacttgctcccgggccgagaacttctgctgcagacaaacctcatcaac
tatgtcaccagcatccgccccaacatctttgtgggccgagcagagggctccacgcagtat
ggcaaatggtactttgaggtgatggtggatgaggtggctccatttctgacagctcaggcc
acccacctgagggtgggctgggccctcagcgagggctacagcccctaccccggaggcggc
gagggctggggcggcaacggggtcggcgatgatctctattcttacggctttgatgggctg
catctttggacagggcatgtggcacgcccagtgacttctccgggacaacacctcttggcc
ccggaggatgtggtcagctgctgcctggacctcagcgtcccgtccatctcctttcgtatc
aacggctgccccgtgcagggtgtctttgaatccttcaacctcgatgggctcttcttccct
gtcgtgagcttctcggctggtatcaaagtgcgcttcctccttggtggccgccatggtgaa
tttaagttcctgcccccacctggctatgctccatgccatgaagctgtgctccctcgggag
cggctccatctccaacccatcaaagagtatcgcagggaggggcctcgggggccccacctg
gtgggccccagtcgctgcctctcacatctggactttgtaccctgtcctgtggacaccatc
cagatcgtcttgcccccccacctggagcggattcgggagaagctggcagagaacattcat
gaactctgggcactgactcgcattgagcaaggatggacctatggtccggtacgggatgac
aacaagaggctgcacccatgtcttgtgaatttccacagcttgccagaacctgagcggaat
tacaacttgcagatgtcaggggagacactcaagactctgctggccctgggctgccacgtg
ggcatggcagatgagaaggcagaagacaacctgaagaagacgaagctgcctaagacgtat
atgatgagcaatggatacaagccggctcctctggacctgagccacgtgaggctgacgcct
gcacagacaactctggtggaccggctggcagagaacgggcacaatgtctgggcgagagac
cgcgtggcacaaggctggagctacagtgctgtgcaggacatccctgcacgcagaaatcct
cgcctcgtgccctaccgcctgctggacgaggccaccaagcgcagcaatagggacagcctc
tgccaggctgtgcgcaccctgctgggctatggctacaacatcgagcctcctgaccaggag
cccagtcaggtggacagccagtctcgtggtgaccgggcccgcatcttccgggcagagaag
tcctatgcagtccagagcggccgctggtacttcgagtttgaagcagtcaccacaggagag
atgcgagtgggctgggcaaggcctgagctgagacctgatgtggagctgggagcggacgat
ttggcctatgtcttcaatgggcatcgaggccagcgctggcacttgggcagtgagccattt
gggcgcccctggcagtcgggcgatgtcgtcggctgcatgattgatctcacagagaacacc
atcatcttcaccctcaatggcgaggtcctcatgtctgactcgggctcggaaacagccttc
cgtgacattgagataggggacggcttcctgccagtctgcagcttgggacctggtcaggtg
ggccacctgaacctgggccaggatgtgagctccctgaggttttttgccatctgtggcctc
caggaaggctttgagccgttcgccatcaacatgcaacgcccagttaccacctggtttagc
aagagtcttcctcagtttgagcctgtgcccctcgaacacccgcactatgaggtggcccgc
atggatggcactgtggatacacccccctgcctgcgcttgacccaccgcacctggggttca
cagaacagtctggtggagatgctgtttctccggctaagccttccggtccagttccaccag
cacttccgctgcaccgcaggggccacacccctggcatcccctggcctgcagcctcctgct
gaagatgaggcccgggcagcagaaccggatacggactatgaaaacctgcgccgctccgct
ggaggctggggagaggctgaagggggcaaggatggaactgccaaggaggggacacccgga
ggcactgcccaggctggggtagaggctcagcctgcgagggcggagaatgagaaagacgct
accaccgagaagaacaagaagagagggttcttgttcaaggccaagaaggttgccatgatg
acccaaccaccttccactccggctcttccccgactccctcgagatgtggtacctgctgac
aaccgcgacgaccctgagatcatcctcaacaccaccacgtactattactctgtgagggtc
ttcgcgggtcaggagcccagctgcgtgtgggtgggctgggtcactcctgactaccatcaa
catgacatgagcttcgacctcagcaaagtcagggcggtgacagtgaccatgggagatgaa
caaggcaatgtccacagcagcctcaagtgtagcaactgctacatggtgtggggtggagat
tttgtgagtcccggacagcagggccgaatcagccacacagaccttgtcattggctgcctg
gtggatctggccaccggcttaatgaccttcacagccaatgggaaagaaagcaacaccttc
ttccaggtggaacccaacacgaagctgtttcctgctgtcttcgtgctgcccacccaccag
aacgtggtccagtttgagctggggaagcagaagaacatcatgccgctgtcagccgccatg
ttcctgagcgagcgcaagaacccagccccacagtgcccaccaaggctggaggtgcagatg
ctgatgcctgtctcgtggagccgaatgcccaaccacttcctacaggtggacacgcggcgt
gctggagagcggctgggctgggcagttcagtgccaggagccgctgatgatgatggcgcta
cacatcccggaggagaacaggtgcatggacatcctagagctatctgagcggctggaccta
cagcgcttccactcacacacgctctcgctctaccgctcggtgtgtgccctgggcaacaac
cgcgtggctcatgccctgtgcagccacgtggaccaggcacagctgttgcatgcgctggag
gatgcgcgcttgccaggtcctctgcgagcaggctactacgacctcctcatcagcatccac
ctcgaaagcgcctgccgcagccgtcgctccatgctctctgagtacatcgtgccactcacg
ccggagacccgcgccatcacgcttttcccacctgggcgaagtgcggaagatggcccccgc
cgccatggcctgcctggcgttggggtcacaacctccctgagacctccacaccatttctca
cccccgtgttttgtggtcgccctgccagctgctggggccacagaagctccggctcgcctc
agccctgccatccctctggaggctctgcgagacaaggcgctgagaatgttgggggaagcc
gtgcgtgatggaggacagcatgctcgcgacccggttgggggctctgtggagttccagttc
gtcccggtgctcaagcttgtgtctaccctcctggtgatgggtgtctttagtgacgaggat
gtgaagcagatcctgaagatgattgagcctgaagtcttcagggaggaagaagaggtggag
gaggagggagaggaggaagaggaagatgaggaggagaaagaggaggatgaagaagaagag
gcacacgagaaggaagatgaggaaaaagaagaggcagaggatgctgcagaagaggagaag
gaagagcttgaggaggggctgctgcagatgaagctgcccgagtctgtgaaattacagatg
tgccacctcctggagtatttctgtgaccaagagctgcagcaccgggtggagtccttggcg
gcctttgcagagtgttatgtggacaagatgcagggcaaccagcggggtcgctacggcctc
ctcatgaaagccttcaccatgagcgcagccgagaccgcaaggcgcacccgagagttccgt
tctccaccccaggagcagatcaacatgctattgcacttcaaaaatggtgctgatgaggaa
gagtgtcctctccctgaagagatccgacaggagttagtcaactttcaccaagacctgctg
gcacattgtggaatccagttggagggagaggaggaggagccagaggaggagagcactctg
ggaagccgcctcatgagcttgttggaaaaagtaaagctggtgaagaagacagaggagaag
cctgaggaggagccggcacctgaggagcacaagcctcagtccttgcaggagctggtgtcc
cacacagtggtgcgctgggcccaggaggacttcgttcagagcccggagctggtccgtgcc
atgttcagcctcctgcatcggcagtatgacgggctcggcgagctgctgcgtgccctgccc
cgggcctacacaatctctgtgtcctcggtggaggataccatgagcctgctggagtgcctg
ggccagatccgctcactgctcattgtgcagatgggtccccaggaggagaaccttatgatc
cagagcattgggaacatcatgaataacaaagtcttctaccaacacccaaacctgatgaga
gcgctgggtatgcatgaaacagtcatggaggttatggtgaacgtccttgggggcggcgag
tcaaaggagatccgcttccccaagatggtgacaagctgctgccgcttcctctgctacttc
tgccgaatcagccggcagaaccagcgctccatgtttgaccacctgagctacctgctggag
aacagcggcattggcctgggcatgcagggctccacacccttggatgtagctgctgcttct
gtcattgacaacaacgagctagccttggcattacaagagcaagacctggaaaaggttgtg
tcatacctggcagggtgtggcttacaaagctgccccatgcttctggccaaagggtatcct
gacatcggatggaatccctgtgggggcgaacgctacctcgacttcctgcgttttgctgtc
tttgtcaacggtgagagcgtggaagagaacgctaacgtggttgtgcggctgttgatccgc
aaacccgagtgctttggacctgccctgaggggtgagggtggctcagggctgctggctgcc
atcgaagaggccatccgaatctctgaggatcccgcacgggatgggccgggtgtccgcagg
gaccggcgacgtgagcactttggtgaggagccccctgaagaaaaccgggtacacctggga
catgccatcatgtccttctatgctgccttgattgacctgctaggacgctgtgcacctgag
acgcatttgattcaagccggtaagggtgaggccctgaggatccgtgccatccttcggtcc
ctcgtgcccttggatgacctcgtgggcatcatcagcctcccactgcagatccccaccctg
ggcaaagatggcgcactggttcagccgaagatgtctgcatccttcgtgcctgaccacaag
gcatccatggtgcttttcctggaccgagtgtatggcattgagaaccaggacttcttgctg
catgtgctggatgtggggttccttcctgacatgagggcggctgcttcactggacacggct
actttcagcaccacggagatggcgctggcactgaaccgctacctctgtctggctgtgctg
ccgctcatcaccaagtgcgcgccactctttgcgggcaccgagcaccgcgccatcatggtg
gactccatgctacacacagtgtaccggctgtcgcggggccgctcgctcaccaaagcacag
cgcgacgtcatcgaggactgcctcatggcgctgtgcaggtatatccgcccgtccatgctg
cagcacctgcttcgacgcctggtgttcgatgtgcccatcctcaatgagttcgccaagatg
ccactcaagctccttaccaaccactatgagcgttgctggaagtactactgcctccccaca
ggctgggccaacttcggggtcacctctgaggaagagctgcacctcacacgcaagctcttc
tggggcatctttgattctctggcgcataagaaatacgaccaggagctttaccgaatagcc
atgccttgcctgtgtgccatcgcgggcgcactgccccctgactacgtggacgcctcatac
tcatccaagacggagaaaaaagccacagtggacgctgaaggcaactttgatccccggcct
gtggagaccctcaacgtcatcatccccgagaagctggactccttcattaacaagttcgca
gagtacacccatgagaagtgggccttcgacaagattcagaacaattggtcctatggtgag
aacattgatgaagaattgaagacccaccccatgctgagaccctacaagaccttctcagag
aaggacaaagagatttaccgttggcccatcaaggagtctttgaaggccatgattgcctgg
gaatggacagtagagaaggccagggaaggcgaggaggagaagacggaaaagaaaaaaaca
agaaagatatcccaaaccgcccagacatatgacccccgagaaggctacaatccccagcca
ccagacctcagcgtggttacgttgtcccgggagctgcaggccatggccgaacaactggca
gaaaattaccacaacacttgggggcgaaagaagaagcaagagctggaggctaaaggaggt
gggtctcatcctctactggttccctacgacacgctcacggccaaggagaaggcacgggat
cgagagaaggcccaggagttgctgaagtttctgcagatgaatggctatgctgtcaccagg
ggtcttaaggacatggaactggacacatcctccattgagaagcgatttgccttcggcttc
ctgcagcagctgcttcgctggatggacatctcccaggagttcatcgcccacctggaggct
gtggttagcagtggacgggtggagaaatccccacatgaacaggagattaaattctttgct
aagattctgctgcctttgatcaaccaatacttcaccaaccactgtctctacttcctatcc
acaccagccaaagtgctgggcagtggtggccatgcctccaacaaggagaaggaaatgatc
accagcctcttctgtaaacttgctgcccttgtccgccaccgagtctccctctttgggacg
gatgccccagctgtggtcaactgtcttcacatattggcacgctctctagatgccagaacg
gtgatgaaatcgggccctgagatcgtaaaggcgggtctgcgctccttcttcgagagtgcc
tccgaggacattgagaagatggtggagaacctgcggctaggaaaggtgtcgcaggcgcgc
acgcaggtgaagggcgtgggccagaacctcacctacaccacggtggctctgctgcccgtc
ctcaccaccctcttccagcacatcgcccagcaccagttcggagacgatgtcatcctggat
gacgtacaagtgtcttgctaccgaacgctctgcagtatctactctctgggaaccaccagg
aacccctatgtggaaaaactgcggccagccctgggggaatgcctggcccgcctggccgca
gccatgccagtggcattcctggagcctgagctgaatgaatacaacgcctgctctgtctac
accaccaagtctcctcgagagcgggccatcctggggcttcccaacagcgtggaggagatg
tgtcctgacatcccagtgctagaaaggctcatggcagaaatcggggggctggccgagtcc
ggagcacgctacacagagatgccgcatgtcatcgagattacgttgcctatgctgtgcagc
tacctgccccgctggtgggagcgagggcctgaggcgcccccaccagccctgcctgcgggc
gccccgccaccctgtacagcggtcacctccgaccacctcaattccctcctggggaacatc
ctccgaatcattgtgaacaacctgggcatcgatgaggcctcgtggatgaagcggctggcc
gtgtttgcccagcccattgtgagccgtgccaggccggagctcctacgctcccacttcatc
cctaccatcgggcgattgcgtaagcgggcagggaaggtggtggctgaggaggagcagctg
cgcctggaagccaaggcagaagctgaggagggtgagctcctggtccgggacgagttctcc
gtgctctgccgcgacctgtatgccctctacccactgctcatccgctacgtagacaacaac
agggcacactggctgacagagcccaaccccaatgcagaggagctgttcaggatggtggga
gaaatcttcatctactggtccaagtcccacaactttaagcgtgaagaacagaacttcgtg
gtccagaatgaaatcaacaacatgtcctttttgacagctgacaataagagcaaaatggcc
aaggcaggagacgtacagtcaggtggctcagatcaggaacgcaccaagaagaagcgccgg
ggggaccgctactccgtgcagacatccttgatcgtggccacactcaagaagatgttgccg
atcggactaaacatgtgtgctcccaccgaccaggacctcattgtgctggccaaagcccgc
tatgccctgaaagatacagatgaggaggtccgtgaattccttcaaaacaaccttaacctt
cagggaaaggtggaaggctcaccatctcttcgctggcaaatggcactgtaccgcggcgtc
ccaggccgcgaggaagatgccgatgatcccgagaaaatcgtgcgcagagttcaggaagtg
tccgcagtgctctatcacctggaccagacggagcatccttacaagtccaagaaggcggtg
tggcataaacttctgtccaagcagcgccggagggctgtggtggcctgtttccgcatgacg
cccctgtacaacttgcccacgcaccgagcgtgtaacatgttcttggagagctacaaagcc
tcctggatcctgactgaggaccacagtttcgaggaccgcatgatagatgacctatcgaaa
gctggagagcaggaagaagaggaggaagaggtggaggagaagaagccagaccccttacac
cagttggtcctacacttcagccgcacagctctaactgaaaagagcaaactggacgaagac
tacctatacatggcttacgctgacatcatggcaaagagctgccacctggaggagggcggg
gaaaatggcgaagaaggaggcgaagaagaggaagtggaggtgtcctttgaggagaaggag
atggagaaacagaggctcctgtaccagcagtcaaggctgcacaaccggggtgctgctgag
atggtactgcagatgatcagtgcctgcaaaggagaaacgggtgccatggtgtcttccacc
ctgaagctgggtatctccatccttaacggagggaacgctgaagtgcagcagaaaatgctg
gattacctgaaggacaagaaggaagtgggcttcttccagagtatccaggcgctgatgcaa
acgtgcagcgtcctggacctcaatgccttcgagaggcagaacaaggcagaggggctgggc
atggtgaacgaggacggaactgtcatcaatcgccaaaacggagagaaagtcatggcggat
gacgagttcacacaggacctgttccgcttcctgcagctgctctgcgaggggcacaacaat
gatttccaaaactacctacggacacagactgggaacacgaccaccatcaatatcattatc
tgcacagtggactacctcctgcggctgcaggaatccatcagtgacttctactggtattac
tcgggcaaggatgtcatcgaggaacagggaaagagaaacttctccaaagccatgtcggta
gctaaacaagtgttcaacagcctcaccgagtacatccagggaccctgcaccggaaaccag
cagagtctggcgcacagtcgcctctgggatgccgtggtgggcttcctgcacgtgttcgcg
cacatgatgatgaagctggctcaggactccagccagatagagctgctgaaggagctgctg
gacctacagaaggacatggtggtgatgctgctgtccctcctggaaggaaacgtggtgaac
ggtatgatcgcgcggcagatggtggacatgctcgtggagtcttcgtccaatgtggagatg
attctcaagttcttcgacatgtttctgaaactcaaggacatcgtaggctctgaggccttc
caggactatgtcacagacccccgtggcctcatctccaagaaggacttccagaaggccatg
gacagccagaagcagttcactggcccagagatccagttcctgctctcgtgttccgaagca
gatgagaatgagatgatcaactgcgaagagtttgcgaaccgcttccaggaaccagcacgg
gacattggcttcaacgtggcggtgctgcttaccaacctgtcagagcatgtgccccacgac
ccgcgcctgcgcaacttcctggagctggctgagagcatcctggagtacttccggccttac
ctgggccgcatcgaaatcatgggcgcatcgcgtcgcatagaacggatctattttgagatc
tcagagaccaaccgtgcccagtgggagatgccccaggtgaaggagtccaagcgccagttc
atcttcgacgtggtgaacgagggcggcgagtccgagaagatggagatgttcgtgagtttc
tgcgaggacacgatctttgagatgcagatcgcagctcagatctccgagcctgagggcgag
ccggaggaggacgaggacgagggcgcagaggaggctgaggagggcgcggcgggttccgac
gggtcgggctctgcagcggctgcgggcgtgtgggtgtggctggcagcgactgcgggccga
actctacggggtctgagctaccggagcctgcggcgacgcgtgcggaggctgcggcggctg
acggcgcgggaggctgccacggcggtggccgcgctgctctgggcgctggtgacccgcgcg
gggggcgcgggcgcgggcgcggcagccggggcgctgcggctgctctggggctcgctgttt
ggcggtgggctggtagacagcgccaagaaggtgacagtgacggagctcctggcaggcatg
ccggaccccaccggcgacgaggtgcacggccagcagccgagcggcgctggcagcgatgca
gagggcgagggtgagggagaaggcgaaggcgatgctgccgacggcgccggagatgaagag
gctgcagcggaccaggctggcacgggaggtgccgacggggcggtggccgtggcagatggg
agtcccttccggccagaaggcgccggtggtctcggggatatgggtgacacgacgccagtg
gagccccccacgccagaaggctcgcctatcctcaagaggaagctgggggtggatggagaa
gaggaggagccgcccccggagccggagccagagccggagcccgaaccggagaaagctgat
acagagaatggagagaaggaagtccccgagccacctccagagccccccaagaagacacca
cctccaccccctccaaagaaggaggaagctggaggagcaggcctggaagaattctggggt
gaactggaagtacagagagtgaaattcttgaactacttgtcgaggaatttctacacactg
cggttcctggccctcttcctggcctttgccatcaacttcatcttactgttttataaggtc
tcagactctccaccaggggaggatgacatagaaggttccggtgctggggacatgtcaggg
gcagggtctggtgatggctctggctggggctccagggccggcgaggaggtagagggcgat
gaagatgagaacatggtgtactacttcctggaggagagcaccggctacatggagcctgcc
ctgaggtgcttgagcctgctgcacacgctggtggcctttctctgcatcattggctacaac
tgtctcaaggtgccccttgtcatcttcaagcgggagaaggagctggcccggaagctggag
tttgatggcctctacattacagagcagcccgaggatgatgacgtgaagggacagtgggac
cgcctggtgctcaacacgccgtctttccctagcaactactgggacaagtttgtcaagcgg
aaggttctggacaaacacggggacatctttgggcgggagcggattgcggagctgctgggc
atggatctggcctctctggagatcacagcccacaatgagcgcaaacctgaccctccaccg
ggcctgctgacatggatcatgtctatcgatgtcaaataccagatctggaagtttggagtc
atcttcacagacaactctttcctgtatctgggctggtacatggtgatgtccctcctgggg
cactacaataacttcttctttgctgcccacctcctggacatcgccatgggagtcaagacg
ctccgcaccatcctttcatctgtcactcacaatggaaagcagctggtgatgaccgtaggg
ctcctggccgtagtggtctacttgtatacagtggtggccttcaacttcttccgcaaattc
tacaacaagagcgaagatgaggacgagcctgacatgaagtgtgatgacatgatgacgtgc
tacctgttccacatgtatgtgggcgtccgggccggtggagggatcggggacgagatcgag
gacccggccggcgatgaatatgaactttaccgggtcgtcttcgacatcacctttttcttc
ttcgttatcgtcattctgctggctatcattcagggtctgattattgatgcttttggggag
ctccgagaccaacaagagcaagtgaaggaagacatggagaccaagtgcttcatctgtgga
ataggcagtgactacttcgacacaaccccacatgggtttgagacccacactctagaagag
cacaacctagccaattacatgtttttcctgatgtatttgataaataaggatgagacagag
cacactggtcaggagtcgtatgtctggaagatgtaccaggaaaggtgctgggatttcttc
cctgctggagactgtttccgcaagcagtatgaggaccagcttagctga

DBGET integrated database retrieval system