KEGG   Mus musculus (mouse): 20190
Entry
20190             CDS       T01002                                 

Gene name
Ryr1, AI528790, R, RYR-1, Ryr, s, skrr
Definition
(RefSeq) ryanodine receptor 1, skeletal muscle
  KO
K04961  ryanodine receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04730  Long-term depression
mmu04921  Oxytocin signaling pathway
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20190 (Ryr1)
   04020 Calcium signaling pathway
    20190 (Ryr1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    20190 (Ryr1)
  09156 Nervous system
   04730 Long-term depression
    20190 (Ryr1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    20190 (Ryr1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    20190 (Ryr1)
   05020 Prion disease
    20190 (Ryr1)
   05022 Pathways of neurodegeneration - multiple diseases
    20190 (Ryr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    20190 (Ryr1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20190 (Ryr1)
   04040 Ion channels [BR:mmu04040]
    20190 (Ryr1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20190 (Ryr1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   20190 (Ryr1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ryanodine receptor
   20190 (Ryr1)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 Serglycin
Other DBs
NCBI-GeneID: 20190
NCBI-ProteinID: NP_033135
MGI: 99659
Ensembl: ENSMUSG00000030592
Vega: OTTMUSG00000059211
UniProt: E9PZQ0
Position
7 B1; 7 16.94 cM
AA seq 5035 aa
MGDGGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVP
PDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLS
CLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERY
LHLSTASGELQVDASFMQTLWNMNPICSGCEEGFVTGGHVLRLFHGHMDECLTISPSDSD
DQRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLGLTEDQGL
VVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTY
AAPDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLD
SFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQ
EEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCAL
FSTNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKV
LDVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQY
GKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGL
HLWTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFP
VVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHL
VGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDD
NKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTY
MMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNP
RLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRARIFRAEK
SYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPF
GRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQV
GHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEVAR
MDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLASPGLQPPA
EDEARAAEPDTDYENLRRSAGGWGEAEGGKDGTAKEGTPGGTAQAGVEAQPARAENEKDA
TTEKNKKRGFLFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDDPEIILNTTTYYYSVRV
FAGQEPSCVWVGWVTPDYHQHDMSFDLSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD
FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQ
NVVQFELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRR
AGERLGWAVQCQEPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRSVCALGNN
RVAHALCSHVDQAQLLHALEDARLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLT
PETRAITLFPPGRSAEDGPRRHGLPGVGVTTSLRPPHHFSPPCFVVALPAAGATEAPARL
SPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDED
VKQILKMIEPEVFREEEEVEEEGEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEDAAEEEK
EELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAECYVDKMQGNQRGRYGL
LMKAFTMSAAETARRTREFRSPPQEQINMLLHFKNGADEEECPLPEEIRQELVNFHQDLL
AHCGIQLEGEEEEPEEESTLGSRLMSLLEKVKLVKKTEEKPEEEPAPEEHKPQSLQELVS
HTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISVSSVEDTMSLLECL
GQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGE
SKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAAS
VIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAV
FVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRR
DRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPETHLIQAGKGEALRIRAILRS
LVPLDDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLL
HVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMV
DSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKM
PLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIA
MPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFA
EYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAW
EWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLA
ENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTR
GLKDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFA
KILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGT
DAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQAR
TQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTR
NPYVEKLRPALGECLARLAAAMPVAFLEPELNEYNACSVYTTKSPRERAILGLPNSVEEM
CPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAG
APPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFI
PTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNN
RAHWLTEPNPNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMA
KAGDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKAR
YALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEV
SAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKA
SWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDED
YLYMAYADIMAKSCHLEEGGENGEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAE
MVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQ
TCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNN
DFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSV
AKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELL
DLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAF
QDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPAR
DIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEI
SETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMEMFVSFCEDTIFEMQIAAQISEPEGE
PEEDEDEGAEEAEEGAAGSDGSGSAAAAGVWVWLAATAGRTLRGLSYRSLRRRVRRLRRL
TAREAATAVAALLWALVTRAGGAGAGAAAGALRLLWGSLFGGGLVDSAKKVTVTELLAGM
PDPTGDEVHGQQPSGAGSDAEGEGEGEGEGDAADGAGDEEAAADQAGTGGADGAVAVADG
SPFRPEGAGGLGDMGDTTPVEPPTPEGSPILKRKLGVDGEEEEPPPEPEPEPEPEPEKAD
TENGEKEVPEPPPEPPKKTPPPPPPKKEEAGGAGLEEFWGELEVQRVKFLNYLSRNFYTL
RFLALFLAFAINFILLFYKVSDSPPGEDDIEGSGAGDMSGAGSGDGSGWGSRAGEEVEGD
EDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLE
FDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLG
MDLASLEITAHNERKPDPPPGLLTWIMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLG
HYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKF
YNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFF
FVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEE
HNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
NT seq 15108 nt   +upstreamnt  +downstreamnt
atgggtgatggaggaggtgaaggcgaggacgaggtccagtttttgcggacggatgatgaa
gtggtcctgcagtgcagcgccacggtgctcaaggaacagctgaagttgtgtctggccgct
gaggggttcggcaaccgcctttgctttctggaacccaccagcaacgcgcagaatgtaccc
cctgatctggccatctgctgcttcatcctggagcagtctctgtcagttcgagccctgcag
gagatgctggccaatactgtggaggccggtgtggagtcatcccagggcgggggacacagg
acactcttgtatggccacgccatcctgctccggcacgcacacagtcgtatgtacctgagt
tgcctcaccacctcccgatccatgactgacaagttggcctttgacgtgggattacaggaa
gacgcaacaggggaggcctgttggtggacgatgcacccagcctcaaagcagaggtctgaa
ggagagaaggttcgagttggggatgaccttatccttgtgagtgtctcctctgagcgatac
ctgcacctgtcaaccgcaagtggggagctccaggttgacgcctcctttatgcagactctg
tggaacatgaatcccatctgctctggctgtgaagaaggctttgtgactggaggccacgtc
ctgcgcctctttcatggacatatggatgaatgtttgaccatctccccttctgacagtgat
gatcaacgcagacttgtctactacgagggagggcctgtgtgcactcatgcccgctcccta
tggaggctagagccgctgagaatcagctggagtggaagccatctccgctggggccagcca
ctaagaatcagacatgtgaccacagggaggtaccttgggctcactgaggaccaaggcctt
gtggtggttgatgccagcaaggcccacaccaaggctacttccttttgcttccgaatctcc
aaggagaagctggatgtggcccccaagagagatgtggagggcatgggtccccctgagatc
aagtatggagagtcgctctgctttgtacagcatgtggcctcaggcctgtggctcacctat
gctgccccagaccctaaggccctgaggcttggggtactcaagaagaaggccatgctgcac
caggaaggtcacatggatgatgcgttgtcactgacgcgatgccagcaggaggagtcccag
gctgcccggatgatatacagcactgccggcctgtacaaccagttcataaagggtctcgat
agcttcagcgggaagccacggggctcggggccaccggctgggtcagcattgcccatcgag
ggcgtcatcctgagcctacaggacctcattggctacttcgagccgccttcagaggagctg
cagcacgaggagaagcagaccaagctgcgcagcctgcgcaaccgacagagcctcttccag
gaggaggggatgctctccctggtcctgaattgcattgaccgcctcaacgtctacaccacc
gctgcccactttgccgagtttgcgggagaggaggcagctgaatcttggaaagagattgtg
aacctgctctatgaacttctagcctctctgatccgtggcaatcgcaccaactgtgcgctc
ttctccacaaacttggattggctggtcagcaagctggatcgtctggaggcctcatctggc
atcctggaggtgttgtactgtgtcctgattgagagtcctgaggtgctgaacatcatccag
gagaaccacatcaagtctatcatctccctcttagacaagcatgggcggaatcacaaggtc
ctggatgtgctgtgctcactctgtgtgtgcaatggtgtggctgtacgctccaaccaggac
ctcatcaccgagaacttgctcccgggccgagaacttctgctgcagacaaacctcatcaac
tatgtcaccagcatccgccccaacatctttgtgggccgagcagagggctccacgcagtat
ggcaaatggtactttgaggtgatggtggatgaggtggctccatttctgacagctcaggcc
acccacctgagggtgggctgggccctcagcgagggctacagcccctaccccggaggcggc
gagggctggggcggcaacggggtcggcgatgatctctattcttacggctttgatgggctg
catctttggacagggcatgtggcacgcccagtgacttctccgggacaacacctcttggcc
ccggaggatgtggtcagctgctgcctggacctcagcgtcccgtccatctcctttcgtatc
aacggctgccccgtgcagggtgtctttgaatccttcaacctcgatgggctcttcttccct
gtcgtgagcttctcggctggtatcaaagtgcgcttcctccttggtggccgccatggtgaa
tttaagttcctgcccccacctggctatgctccatgccatgaagctgtgctccctcgggag
cggctccatctccaacccatcaaagagtatcgcagggaggggcctcgggggccccacctg
gtgggccccagtcgctgcctctcacatctggactttgtaccctgtcctgtggacaccatc
cagatcgtcttgcccccccacctggagcggattcgggagaagctggcagagaacattcat
gaactctgggcactgactcgcattgagcaaggatggacctatggtccggtacgggatgac
aacaagaggctgcacccatgtcttgtgaatttccacagcttgccagaacctgagcggaat
tacaacttgcagatgtcaggggagacactcaagactctgctggccctgggctgccacgtg
ggcatggcagatgagaaggcagaagacaacctgaagaagacgaagctgcctaagacgtat
atgatgagcaatggatacaagccggctcctctggacctgagccacgtgaggctgacgcct
gcacagacaactctggtggaccggctggcagagaacgggcacaatgtctgggcgagagac
cgcgtggcacaaggctggagctacagtgctgtgcaggacatccctgcacgcagaaatcct
cgcctcgtgccctaccgcctgctggacgaggccaccaagcgcagcaatagggacagcctc
tgccaggctgtgcgcaccctgctgggctatggctacaacatcgagcctcctgaccaggag
cccagtcaggtggacagccagtctcgtggtgaccgggcccgcatcttccgggcagagaag
tcctatgcagtccagagcggccgctggtacttcgagtttgaagcagtcaccacaggagag
atgcgagtgggctgggcaaggcctgagctgagacctgatgtggagctgggagcggacgat
ttggcctatgtcttcaatgggcatcgaggccagcgctggcacttgggcagtgagccattt
gggcgcccctggcagtcgggcgatgtcgtcggctgcatgattgatctcacagagaacacc
atcatcttcaccctcaatggcgaggtcctcatgtctgactcgggctcggaaacagccttc
cgtgacattgagataggggacggcttcctgccagtctgcagcttgggacctggtcaggtg
ggccacctgaacctgggccaggatgtgagctccctgaggttttttgccatctgtggcctc
caggaaggctttgagccgttcgccatcaacatgcaacgcccagttaccacctggtttagc
aagagtcttcctcagtttgagcctgtgcccctcgaacacccgcactatgaggtggcccgc
atggatggcactgtggatacacccccctgcctgcgcttgacccaccgcacctggggttca
cagaacagtctggtggagatgctgtttctccggctaagccttccggtccagttccaccag
cacttccgctgcaccgcaggggccacacccctggcatcccctggcctgcagcctcctgct
gaagatgaggcccgggcagcagaaccggatacggactatgaaaacctgcgccgctccgct
ggaggctggggagaggctgaagggggcaaggatggaactgccaaggaggggacacccgga
ggcactgcccaggctggggtagaggctcagcctgcgagggcggagaatgagaaagacgct
accaccgagaagaacaagaagagagggttcttgttcaaggccaagaaggttgccatgatg
acccaaccaccttccactccggctcttccccgactccctcgagatgtggtacctgctgac
aaccgcgacgaccctgagatcatcctcaacaccaccacgtactattactctgtgagggtc
ttcgcgggtcaggagcccagctgcgtgtgggtgggctgggtcactcctgactaccatcaa
catgacatgagcttcgacctcagcaaagtcagggcggtgacagtgaccatgggagatgaa
caaggcaatgtccacagcagcctcaagtgtagcaactgctacatggtgtggggtggagat
tttgtgagtcccggacagcagggccgaatcagccacacagaccttgtcattggctgcctg
gtggatctggccaccggcttaatgaccttcacagccaatgggaaagaaagcaacaccttc
ttccaggtggaacccaacacgaagctgtttcctgctgtcttcgtgctgcccacccaccag
aacgtggtccagtttgagctggggaagcagaagaacatcatgccgctgtcagccgccatg
ttcctgagcgagcgcaagaacccagccccacagtgcccaccaaggctggaggtgcagatg
ctgatgcctgtctcgtggagccgaatgcccaaccacttcctacaggtggacacgcggcgt
gctggagagcggctgggctgggcagttcagtgccaggagccgctgatgatgatggcgcta
cacatcccggaggagaacaggtgcatggacatcctagagctatctgagcggctggaccta
cagcgcttccactcacacacgctctcgctctaccgctcggtgtgtgccctgggcaacaac
cgcgtggctcatgccctgtgcagccacgtggaccaggcacagctgttgcatgcgctggag
gatgcgcgcttgccaggtcctctgcgagcaggctactacgacctcctcatcagcatccac
ctcgaaagcgcctgccgcagccgtcgctccatgctctctgagtacatcgtgccactcacg
ccggagacccgcgccatcacgcttttcccacctgggcgaagtgcggaagatggcccccgc
cgccatggcctgcctggcgttggggtcacaacctccctgagacctccacaccatttctca
cccccgtgttttgtggtcgccctgccagctgctggggccacagaagctccggctcgcctc
agccctgccatccctctggaggctctgcgagacaaggcgctgagaatgttgggggaagcc
gtgcgtgatggaggacagcatgctcgcgacccggttgggggctctgtggagttccagttc
gtcccggtgctcaagcttgtgtctaccctcctggtgatgggtgtctttagtgacgaggat
gtgaagcagatcctgaagatgattgagcctgaagtcttcagggaggaagaagaggtggag
gaggagggagaggaggaagaggaagatgaggaggagaaagaggaggatgaagaagaagag
gcacacgagaaggaagatgaggaaaaagaagaggcagaggatgctgcagaagaggagaag
gaagagcttgaggaggggctgctgcagatgaagctgcccgagtctgtgaaattacagatg
tgccacctcctggagtatttctgtgaccaagagctgcagcaccgggtggagtccttggcg
gcctttgcagagtgttatgtggacaagatgcagggcaaccagcggggtcgctacggcctc
ctcatgaaagccttcaccatgagcgcagccgagaccgcaaggcgcacccgagagttccgt
tctccaccccaggagcagatcaacatgctattgcacttcaaaaatggtgctgatgaggaa
gagtgtcctctccctgaagagatccgacaggagttagtcaactttcaccaagacctgctg
gcacattgtggaatccagttggagggagaggaggaggagccagaggaggagagcactctg
ggaagccgcctcatgagcttgttggaaaaagtaaagctggtgaagaagacagaggagaag
cctgaggaggagccggcacctgaggagcacaagcctcagtccttgcaggagctggtgtcc
cacacagtggtgcgctgggcccaggaggacttcgttcagagcccggagctggtccgtgcc
atgttcagcctcctgcatcggcagtatgacgggctcggcgagctgctgcgtgccctgccc
cgggcctacacaatctctgtgtcctcggtggaggataccatgagcctgctggagtgcctg
ggccagatccgctcactgctcattgtgcagatgggtccccaggaggagaaccttatgatc
cagagcattgggaacatcatgaataacaaagtcttctaccaacacccaaacctgatgaga
gcgctgggtatgcatgaaacagtcatggaggttatggtgaacgtccttgggggcggcgag
tcaaaggagatccgcttccccaagatggtgacaagctgctgccgcttcctctgctacttc
tgccgaatcagccggcagaaccagcgctccatgtttgaccacctgagctacctgctggag
aacagcggcattggcctgggcatgcagggctccacacccttggatgtagctgctgcttct
gtcattgacaacaacgagctagccttggcattacaagagcaagacctggaaaaggttgtg
tcatacctggcagggtgtggcttacaaagctgccccatgcttctggccaaagggtatcct
gacatcggatggaatccctgtgggggcgaacgctacctcgacttcctgcgttttgctgtc
tttgtcaacggtgagagcgtggaagagaacgctaacgtggttgtgcggctgttgatccgc
aaacccgagtgctttggacctgccctgaggggtgagggtggctcagggctgctggctgcc
atcgaagaggccatccgaatctctgaggatcccgcacgggatgggccgggtgtccgcagg
gaccggcgacgtgagcactttggtgaggagccccctgaagaaaaccgggtacacctggga
catgccatcatgtccttctatgctgccttgattgacctgctaggacgctgtgcacctgag
acgcatttgattcaagccggtaagggtgaggccctgaggatccgtgccatccttcggtcc
ctcgtgcccttggatgacctcgtgggcatcatcagcctcccactgcagatccccaccctg
ggcaaagatggcgcactggttcagccgaagatgtctgcatccttcgtgcctgaccacaag
gcatccatggtgcttttcctggaccgagtgtatggcattgagaaccaggacttcttgctg
catgtgctggatgtggggttccttcctgacatgagggcggctgcttcactggacacggct
actttcagcaccacggagatggcgctggcactgaaccgctacctctgtctggctgtgctg
ccgctcatcaccaagtgcgcgccactctttgcgggcaccgagcaccgcgccatcatggtg
gactccatgctacacacagtgtaccggctgtcgcggggccgctcgctcaccaaagcacag
cgcgacgtcatcgaggactgcctcatggcgctgtgcaggtatatccgcccgtccatgctg
cagcacctgcttcgacgcctggtgttcgatgtgcccatcctcaatgagttcgccaagatg
ccactcaagctccttaccaaccactatgagcgttgctggaagtactactgcctccccaca
ggctgggccaacttcggggtcacctctgaggaagagctgcacctcacacgcaagctcttc
tggggcatctttgattctctggcgcataagaaatacgaccaggagctttaccgaatagcc
atgccttgcctgtgtgccatcgcgggcgcactgccccctgactacgtggacgcctcatac
tcatccaagacggagaaaaaagccacagtggacgctgaaggcaactttgatccccggcct
gtggagaccctcaacgtcatcatccccgagaagctggactccttcattaacaagttcgca
gagtacacccatgagaagtgggccttcgacaagattcagaacaattggtcctatggtgag
aacattgatgaagaattgaagacccaccccatgctgagaccctacaagaccttctcagag
aaggacaaagagatttaccgttggcccatcaaggagtctttgaaggccatgattgcctgg
gaatggacagtagagaaggccagggaaggcgaggaggagaagacggaaaagaaaaaaaca
agaaagatatcccaaaccgcccagacatatgacccccgagaaggctacaatccccagcca
ccagacctcagcgtggttacgttgtcccgggagctgcaggccatggccgaacaactggca
gaaaattaccacaacacttgggggcgaaagaagaagcaagagctggaggctaaaggaggt
gggtctcatcctctactggttccctacgacacgctcacggccaaggagaaggcacgggat
cgagagaaggcccaggagttgctgaagtttctgcagatgaatggctatgctgtcaccagg
ggtcttaaggacatggaactggacacatcctccattgagaagcgatttgccttcggcttc
ctgcagcagctgcttcgctggatggacatctcccaggagttcatcgcccacctggaggct
gtggttagcagtggacgggtggagaaatccccacatgaacaggagattaaattctttgct
aagattctgctgcctttgatcaaccaatacttcaccaaccactgtctctacttcctatcc
acaccagccaaagtgctgggcagtggtggccatgcctccaacaaggagaaggaaatgatc
accagcctcttctgtaaacttgctgcccttgtccgccaccgagtctccctctttgggacg
gatgccccagctgtggtcaactgtcttcacatattggcacgctctctagatgccagaacg
gtgatgaaatcgggccctgagatcgtaaaggcgggtctgcgctccttcttcgagagtgcc
tccgaggacattgagaagatggtggagaacctgcggctaggaaaggtgtcgcaggcgcgc
acgcaggtgaagggcgtgggccagaacctcacctacaccacggtggctctgctgcccgtc
ctcaccaccctcttccagcacatcgcccagcaccagttcggagacgatgtcatcctggat
gacgtacaagtgtcttgctaccgaacgctctgcagtatctactctctgggaaccaccagg
aacccctatgtggaaaaactgcggccagccctgggggaatgcctggcccgcctggccgca
gccatgccagtggcattcctggagcctgagctgaatgaatacaacgcctgctctgtctac
accaccaagtctcctcgagagcgggccatcctggggcttcccaacagcgtggaggagatg
tgtcctgacatcccagtgctagaaaggctcatggcagaaatcggggggctggccgagtcc
ggagcacgctacacagagatgccgcatgtcatcgagattacgttgcctatgctgtgcagc
tacctgccccgctggtgggagcgagggcctgaggcgcccccaccagccctgcctgcgggc
gccccgccaccctgtacagcggtcacctccgaccacctcaattccctcctggggaacatc
ctccgaatcattgtgaacaacctgggcatcgatgaggcctcgtggatgaagcggctggcc
gtgtttgcccagcccattgtgagccgtgccaggccggagctcctacgctcccacttcatc
cctaccatcgggcgattgcgtaagcgggcagggaaggtggtggctgaggaggagcagctg
cgcctggaagccaaggcagaagctgaggagggtgagctcctggtccgggacgagttctcc
gtgctctgccgcgacctgtatgccctctacccactgctcatccgctacgtagacaacaac
agggcacactggctgacagagcccaaccccaatgcagaggagctgttcaggatggtggga
gaaatcttcatctactggtccaagtcccacaactttaagcgtgaagaacagaacttcgtg
gtccagaatgaaatcaacaacatgtcctttttgacagctgacaataagagcaaaatggcc
aaggcaggagacgtacagtcaggtggctcagatcaggaacgcaccaagaagaagcgccgg
ggggaccgctactccgtgcagacatccttgatcgtggccacactcaagaagatgttgccg
atcggactaaacatgtgtgctcccaccgaccaggacctcattgtgctggccaaagcccgc
tatgccctgaaagatacagatgaggaggtccgtgaattccttcaaaacaaccttaacctt
cagggaaaggtggaaggctcaccatctcttcgctggcaaatggcactgtaccgcggcgtc
ccaggccgcgaggaagatgccgatgatcccgagaaaatcgtgcgcagagttcaggaagtg
tccgcagtgctctatcacctggaccagacggagcatccttacaagtccaagaaggcggtg
tggcataaacttctgtccaagcagcgccggagggctgtggtggcctgtttccgcatgacg
cccctgtacaacttgcccacgcaccgagcgtgtaacatgttcttggagagctacaaagcc
tcctggatcctgactgaggaccacagtttcgaggaccgcatgatagatgacctatcgaaa
gctggagagcaggaagaagaggaggaagaggtggaggagaagaagccagaccccttacac
cagttggtcctacacttcagccgcacagctctaactgaaaagagcaaactggacgaagac
tacctatacatggcttacgctgacatcatggcaaagagctgccacctggaggagggcggg
gaaaatggcgaagaaggaggcgaagaagaggaagtggaggtgtcctttgaggagaaggag
atggagaaacagaggctcctgtaccagcagtcaaggctgcacaaccggggtgctgctgag
atggtactgcagatgatcagtgcctgcaaaggagaaacgggtgccatggtgtcttccacc
ctgaagctgggtatctccatccttaacggagggaacgctgaagtgcagcagaaaatgctg
gattacctgaaggacaagaaggaagtgggcttcttccagagtatccaggcgctgatgcaa
acgtgcagcgtcctggacctcaatgccttcgagaggcagaacaaggcagaggggctgggc
atggtgaacgaggacggaactgtcatcaatcgccaaaacggagagaaagtcatggcggat
gacgagttcacacaggacctgttccgcttcctgcagctgctctgcgaggggcacaacaat
gatttccaaaactacctacggacacagactgggaacacgaccaccatcaatatcattatc
tgcacagtggactacctcctgcggctgcaggaatccatcagtgacttctactggtattac
tcgggcaaggatgtcatcgaggaacagggaaagagaaacttctccaaagccatgtcggta
gctaaacaagtgttcaacagcctcaccgagtacatccagggaccctgcaccggaaaccag
cagagtctggcgcacagtcgcctctgggatgccgtggtgggcttcctgcacgtgttcgcg
cacatgatgatgaagctggctcaggactccagccagatagagctgctgaaggagctgctg
gacctacagaaggacatggtggtgatgctgctgtccctcctggaaggaaacgtggtgaac
ggtatgatcgcgcggcagatggtggacatgctcgtggagtcttcgtccaatgtggagatg
attctcaagttcttcgacatgtttctgaaactcaaggacatcgtaggctctgaggccttc
caggactatgtcacagacccccgtggcctcatctccaagaaggacttccagaaggccatg
gacagccagaagcagttcactggcccagagatccagttcctgctctcgtgttccgaagca
gatgagaatgagatgatcaactgcgaagagtttgcgaaccgcttccaggaaccagcacgg
gacattggcttcaacgtggcggtgctgcttaccaacctgtcagagcatgtgccccacgac
ccgcgcctgcgcaacttcctggagctggctgagagcatcctggagtacttccggccttac
ctgggccgcatcgaaatcatgggcgcatcgcgtcgcatagaacggatctattttgagatc
tcagagaccaaccgtgcccagtgggagatgccccaggtgaaggagtccaagcgccagttc
atcttcgacgtggtgaacgagggcggcgagtccgagaagatggagatgttcgtgagtttc
tgcgaggacacgatctttgagatgcagatcgcagctcagatctccgagcctgagggcgag
ccggaggaggacgaggacgagggcgcagaggaggctgaggagggcgcggcgggttccgac
gggtcgggctctgcagcggctgcgggcgtgtgggtgtggctggcagcgactgcgggccga
actctacggggtctgagctaccggagcctgcggcgacgcgtgcggaggctgcggcggctg
acggcgcgggaggctgccacggcggtggccgcgctgctctgggcgctggtgacccgcgcg
gggggcgcgggcgcgggcgcggcagccggggcgctgcggctgctctggggctcgctgttt
ggcggtgggctggtagacagcgccaagaaggtgacagtgacggagctcctggcaggcatg
ccggaccccaccggcgacgaggtgcacggccagcagccgagcggcgctggcagcgatgca
gagggcgagggtgagggagaaggcgaaggcgatgctgccgacggcgccggagatgaagag
gctgcagcggaccaggctggcacgggaggtgccgacggggcggtggccgtggcagatggg
agtcccttccggccagaaggcgccggtggtctcggggatatgggtgacacgacgccagtg
gagccccccacgccagaaggctcgcctatcctcaagaggaagctgggggtggatggagaa
gaggaggagccgcccccggagccggagccagagccggagcccgaaccggagaaagctgat
acagagaatggagagaaggaagtccccgagccacctccagagccccccaagaagacacca
cctccaccccctccaaagaaggaggaagctggaggagcaggcctggaagaattctggggt
gaactggaagtacagagagtgaaattcttgaactacttgtcgaggaatttctacacactg
cggttcctggccctcttcctggcctttgccatcaacttcatcttactgttttataaggtc
tcagactctccaccaggggaggatgacatagaaggttccggtgctggggacatgtcaggg
gcagggtctggtgatggctctggctggggctccagggccggcgaggaggtagagggcgat
gaagatgagaacatggtgtactacttcctggaggagagcaccggctacatggagcctgcc
ctgaggtgcttgagcctgctgcacacgctggtggcctttctctgcatcattggctacaac
tgtctcaaggtgccccttgtcatcttcaagcgggagaaggagctggcccggaagctggag
tttgatggcctctacattacagagcagcccgaggatgatgacgtgaagggacagtgggac
cgcctggtgctcaacacgccgtctttccctagcaactactgggacaagtttgtcaagcgg
aaggttctggacaaacacggggacatctttgggcgggagcggattgcggagctgctgggc
atggatctggcctctctggagatcacagcccacaatgagcgcaaacctgaccctccaccg
ggcctgctgacatggatcatgtctatcgatgtcaaataccagatctggaagtttggagtc
atcttcacagacaactctttcctgtatctgggctggtacatggtgatgtccctcctgggg
cactacaataacttcttctttgctgcccacctcctggacatcgccatgggagtcaagacg
ctccgcaccatcctttcatctgtcactcacaatggaaagcagctggtgatgaccgtaggg
ctcctggccgtagtggtctacttgtatacagtggtggccttcaacttcttccgcaaattc
tacaacaagagcgaagatgaggacgagcctgacatgaagtgtgatgacatgatgacgtgc
tacctgttccacatgtatgtgggcgtccgggccggtggagggatcggggacgagatcgag
gacccggccggcgatgaatatgaactttaccgggtcgtcttcgacatcacctttttcttc
ttcgttatcgtcattctgctggctatcattcagggtctgattattgatgcttttggggag
ctccgagaccaacaagagcaagtgaaggaagacatggagaccaagtgcttcatctgtgga
ataggcagtgactacttcgacacaaccccacatgggtttgagacccacactctagaagag
cacaacctagccaattacatgtttttcctgatgtatttgataaataaggatgagacagag
cacactggtcaggagtcgtatgtctggaagatgtaccaggaaaggtgctgggatttcttc
cctgctggagactgtttccgcaagcagtatgaggaccagcttagctga

KEGG   Mus musculus (mouse): 20191
Entry
20191             CDS       T01002                                 

Gene name
Ryr2, 9330127I20Rik, RYR-2
Definition
(RefSeq) ryanodine receptor 2, cardiac
  KO
K04962  ryanodine receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04911  Insulin secretion
mmu04921  Oxytocin signaling pathway
mmu04972  Pancreatic secretion
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20191 (Ryr2)
   04020 Calcium signaling pathway
    20191 (Ryr2)
   04024 cAMP signaling pathway
    20191 (Ryr2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    20191 (Ryr2)
   04921 Oxytocin signaling pathway
    20191 (Ryr2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    20191 (Ryr2)
   04261 Adrenergic signaling in cardiomyocytes
    20191 (Ryr2)
  09154 Digestive system
   04972 Pancreatic secretion
    20191 (Ryr2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    20191 (Ryr2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    20191 (Ryr2)
   05022 Pathways of neurodegeneration - multiple diseases
    20191 (Ryr2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    20191 (Ryr2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    20191 (Ryr2)
   05414 Dilated cardiomyopathy
    20191 (Ryr2)
   05415 Diabetic cardiomyopathy
    20191 (Ryr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    20191 (Ryr2)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20191 (Ryr2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ryanodine receptor
   20191 (Ryr2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   20191 (Ryr2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 20191
NCBI-ProteinID: NP_076357
MGI: 99685
Ensembl: ENSMUSG00000021313
UniProt: E9Q401 Q80ZZ5 Q60835
Structure
PDB: 

Position
13 A1; 13 4.38 cM
AA seq 4966 aa
MADAGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNSSWHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFAFRSSKEKLDVGVRKEVDGMGTSEIKYGDSI
CYIQHVDTGLWLTYQAVDVKSARMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKVKLPTIDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEK
VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYHLEAPDQDHASRAEVCSG
TGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDLELGSDDRAFAFDGF
KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNNNTDIMFYRLSMPIECAEVFSKSVAG
GLPGAGFYGPKNDLEDFDVDSDFEVLMKTAHGHLVPDRIDKDKETPKPEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTGHSARLTEDVLADDRDDYEYLMQTSTYYYSVRIFPGQEPAN
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
NNSNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGR
IKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLV
QCLDPLQFMSLHIPEENRSVDILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSH
VDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLF
PDENKKHGLPGIGLSTSLRPRMRFSSPSFVSISNDCYQYSPEFPLDILKAKTIQMLTEAV
KEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAAVPEE
EGGTPEKEISIEDAKLEGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHR
IEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTREFRSPPQEQINMLLNFKD
DKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGSNDLTIRGRLLSLVEKVTYLKK
KQAEKPVASDSRKCSSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRA
LPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNL
MRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYL
LENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLV
SKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGN
GLLAAMEEAIKIAEDPSRDGPSPTSGSSKTLDIEEEEDDTIHMGNAIMTFYAALIDLLGR
CAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGKVVEPDMSAGFC
PDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLC
TAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLR
PSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLS
RKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNF
NPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYK
LLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAAHGY
SPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKE
KAKDREKAQDIFKFLQISGYVVSRGFKDLDLDTPSIEKRFAYSFLQQLIRYVDEAHQYIL
EFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCTGGHASNKEK
EMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLDSVKSALRAFL
DNAAEDLEKTMENLKQGQFTHTRSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDL
ILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPIAFLETHLDKHNVY
SIYNTRSSRERAALSLPANVEDVCPNIPSLEKLMTEIIELAESGIRYTQMPYMMEVVLPM
LCSYMSRWWEHGPENHPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAV
FSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTT
LARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVV
QNEINNMSFLITDTKSKMSKAAISDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNIC
APGDQELIALAKNRFSLKDTEEEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTEDP
SDPERTVERVLGIANVLFHLEQKSKYTGRGYFSLVEHPQRSKKAVWHKLLSKQRKRAVVA
CFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAELPEEDEAMKRV
DPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEK
QKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYL
KEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFR
FLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDIIDEQ
GQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQD
SSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFL
KLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYE
EFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGS
AKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQ
LAAQISESDLNERLANKEESEKERPEEQAPRMGFFSLLTIQSALFALRYNVLTLVRMLSL
KSLKKQMKRMKKMTVKDMVLAFFSSYWSVFVTLLHFVASVCRGFFRIVSSLLLGGSLVEG
AKKIKVAELLANMPDPTQDEVRGDEEEGERKPLESALPSEDLTDLKELTEESDLLSDIFG
LDLKREGGQYKLIPHNPNAGLSDLMTNPVPVPEVQEKFQEQKAKEEKEEKEETKSEPEKA
EGEDGEKEEKAKDEKSKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNM
RMLALFVAFAINFILLFYKVSTSSVVEGKELPTRTSSDTAKVTNSLDSSPHRIIAVHYVL
EESSGYMEPTLRILAILHTIISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQP
SEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSD
AREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAA
HLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDT
PDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAI
IQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFF
LMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
NT seq 14901 nt   +upstreamnt  +downstreamnt
atggctgatgcgggcgaaggcgaggatgagatccagttcctgagaactgatgatgaggtg
gttctgcagtgcacggcgaccatccacaaagaacagcagaagctgtgcttggcagcagaa
ggatttggcaacagactttgttttttggagtctacttccaattccaagaatgttcccccg
gacctgtctatctgcacctttgtgctggagcagtccctgtcagtacgggccctgcaggag
atgctggccaacacagtggaaaagtcagaagggcaggtggatgtggaaaagtggaagttc
atgatgaagactgctcaaggtggaggccaccggacactcctctatggacacgccatattg
ctacgccattcctacagtggtatgtatctttgctgtctctccacctcccggtcttccact
gacaaactggccttcgatgttggccttcaagaggataccacaggggaggcttgctggtgg
accatacatcctgcctctaagcagagatcagaaggagaaaaagtgcgtgttggagatgat
ctcatcttggtcagcgtgtcctcagaaaggtacttgcacttgtcatatggcaacagcagc
tggcatgtggatgctgccttccagcagaccctctggagcgtggcccctatcagctcagga
agtgaagcagcccaaggctatctcattggcggtgatgttctccggctgctgcatgggcac
atggatgaatgtctcactgtcccttcaggagagcatggtgaagaacagcggagaacagtt
cattatgaaggtggtgccgtatcagttcatgcccgctccctctggagactagagacccta
agagtcgcgtggagtggaagccacataagatggggccagccattccgactccggcatgtc
acgacaggaaaatacttaagcctcatggaagacaagaacctcctactcatggacaaagag
aaagcagatgtaaaatcaacagcgtttgccttccggtcttccaaggaaaaattggacgtg
ggggtgaggaaagaagtcgatggcatgggaacctcagaaatcaagtatggagactccatt
tgctacatacaacatgtggatacaggcctgtggctaacctaccaggctgtggatgtgaaa
tcagcacgaatgggatccatccagcgtaaggctatcatgcaccacgaaggccacatggac
gatggtttgaacttatccagatcacagcatgaggagtcccgcactgcccgcgtcattcgg
agcacagtgttcctctttaataggttcataaggggcctggatgctctcagcaagaaagta
aagctgcccaccattgacttgcccatcgagtctgtgagcctgagtttgcaggacctcatc
ggctacttccaccccccagatgagcacttggagcatgaggacaagcagaacaggctgcga
gccctgaagaacaggcagaatctcttccaggaagagggaatgatcaacctggttctggag
tgcatcgaccgcctgcatgtctacagcagtgcagcccactttgcagatgtcgcaggacga
gaagcaggagagtcttggaaatccatcctgaattctctgtatgagttgctggcggcccta
attagaggaaatcgtaaaaactgtgctcagttttctggttccctcgactggctgatcagc
agactggaaagactggaagcatcctcaggtatcctggaggtcctccactgtgtgttagtg
gagagcccagaagctctgaatatcatcaaagaagggcatatcaagtccattatctcgctt
ttagacaagcatgggagaaaccacaaggtcctggatgtgctgtgttctctctgtgtatgc
catggagttgctgtccgctctaatcagcacctcatctgtgataatctcctgccaggacga
gatctcttactgcagacccgtcttgtgaatcatgtcagcagcatgaggcctaatattttc
ctgggtgtcagcgaaggatcagcacagtataagaagtggtactacgagctcatggtggac
cacacggaaccctttgtgacggcagaagccactcacctgcgagtgggctgggcttccact
gaagggtattctccatacccaggtgggggtgaagagtggggtggcaatggcgttggtgac
gacctcttctcctatgggtttgatggccttcacctctggtcaggttgtatagctcggacc
gtgagctcccccaaccagcacctgctgagaactgacgatgtcatcagttgttgtttagat
ctaagtgcccccagcatctcgtttcgcattaatggacaaccggtgcaagggatgtttgag
aacttcaatatcgatggcctgttctttccagttgtcagtttctctgcaggaataaaggtt
cgctttttgcttggggggagacatggagaattcaagtttctccctccacctggctatgca
gcttgctatgaagctgtactacccaaagagaaattgaaggtggaacacagccgagaatat
aagcaggagaggacatacacacgagacctgctggggcctacagtgtccctgacccaagct
gccttcacacctgttcctgtggacaccagccagattgtgttgcctcctcacctggaaagg
ataagagaaagactggcagagaatatccatgagctctgggttatgaataaaattgagctt
ggctggcagtatggtccggttagagatgacaacaagagacagcacccatgtctggtggag
ttctgcaagcttccagaacaggaacgcaactataatttgcagatgtcgcttgaaaccctc
aagactttgctggcattgggatgtcacgtgggtatagctgatgaacatgctgaagagaag
gtgaagaaaatgaaactgcctaagaattaccagctgaccagcggatacaagcctgcccca
atggatctgagctttataaaactaaccccgtctcaggaagcaatggtggacaagttggct
gaaaatgctcacaatgtgtgggcccgggaccgaatccggcaaggctggacttacggcatc
cagcaggatgtaaagaatagaagaaaccctcgtctcgtcccctacactcttctggatgac
agaaccaagaagtccaacaaagacagtctccgagaggcagtgcgcacactgctgggctac
ggctaccacctggaagctcctgatcaggaccatgcctcgagagccgaggtgtgcagcggt
actggggagaggttccgcatcttcagggcagagaagacctatgcggtgaaggctgggcgc
tggtactttgaatttgaggctgtcactgctggagacatgcgggtgggctggagcaggcca
ggctgccaaccagatctagaactgggttctgatgaccgtgcctttgcttttgatggcttt
aaggcacagcggtggcaccagggcaatgaacactacgggcgctcatggcaagctggtgac
gtcgtgggctgcatggttgatatgaatgaacacaccatgatgttcactctgaacggcgag
atcctgctggatgattcaggctctgagctggcattcaaggactttgatgttggtgatgga
ttcatccctgtgtgtagcctcggggtggcacaagtaggcaggatgaactttggaaaggac
gtcagcactttgaaatattttaccatctgtggcttacaagaaggctatgagccatttgcc
gttaatacaaatagggacatcaccatgtggctgagcaagcggcttcctcagttcctccag
gtcccatcaaaccacgaacacattgaggtgaccagaatagatggtaccatagacagttct
ccatgtctgaaggtcactcagaagtcctttggttctcagaacaacaacactgacatcatg
ttttaccgcctgagtatgcccattgaatgtgccgaggtcttctcaaagtcggtggcggga
gggcttcctggtgccggcttctacgggcccaagaatgatttggaggactttgatgtggac
tctgactttgaggttctgatgaagacagctcatggtcatcttgtgcctgaccgcatcgac
aaggacaaagagacccctaagccagagttcaataaccacaaagattatgctcaggaaaag
ccctcacgactaaagcaaagattcttacttagaaggaccaagccagattacagcacaggc
cactctgcaagactcactgaagatgtccttgctgatgaccgggatgactacgagtacctg
atgcagacgtccacatactattactcggtgaggatctttcctggacaagaaccagctaat
gtctgggtgggctggattacatctgacttccaccagtacgacacaggctttgatttggac
agagtgcgcacagtgacggtcaccctaggagatgaaaaaggaaaagtgcatgagagcatc
aaacgcagcaactgctatatggtgtgtgcaggagagagcatgagccccgggcaaggacga
aacaacagcaacgggctggagattggctgtgtggtggatgctgccagtgggctgctcaca
ttcatagccaatggcaaggagctaagcacttactatcaggtggagccaagcacaaagctc
tttcctgcggttttcgcgcaagctacgagtcccaatgttttccagtttgagttgggcaga
ataaagaatgtaatgcctctctccgcgggactgtttaagagcgagcacaaaaaccccgtg
ccccagtgtcctccacgtctgcatgtgcagttcctgtcccatgtcctgtggagccggatg
cccaaccagttcttgaaggtggacgtctctcgaatcagtgaacgccaaggctggctggtg
cagtgtctagatcctctgcagttcatgtccctccatatacctgaggagaacagatctgtt
gacatcttagagctgacagagcaggaggagttgttgcagtttcactatcacaccctccgc
ctctactctgctgtctgcgcccttgggaatcatcgggtggctcacgccctgtgcagccac
gtggacgaacctcagctgctctacgccattgagaacaagtacatgcctggcttgctgcga
gctggctactatgacctgctgattgacatccacctcagctcctatgccaccgccaggctc
atgatgaacaacgaattcatcgtccctatgacagaggagacaaagagcatcaccctcttc
cctgatgagaataagaaacatggcctcccaggcataggccttagcacctccctccggcct
cggatgcgtttttcctccccgagtttcgtgagcattagcaacgactgttatcagtacagt
cccgagtttcctctggacatcctcaaggccaagaccatccagatgctcacagaagccgtg
aaggagggcagcctccacgctcgggatcctgtgggtgggaccacggagttcctctttgtg
cccctcatcaagctgttctacaccctgctcatcatgggcatctttcacaatgaggatttg
aaacacatcctgcagttgatcgagcccagtgtgtttaaggaagctgccgttccagaggag
gaaggaggcaccccggagaaggagatcagtatagaagacgccaagctggaaggcgaagaa
gaagccaaagggggtaaaaggcccaaggaaggcttgctccagatgaaactcccggagcca
gttaaactacagatgtgcctcttgcttcagtacctctgtgactgccaggttaggcaccgg
atcgaagccattgtagccttttcagatgactttgtagctaaactccaagacaaccaacgg
ttcaggtataatgaagtcatgcaagccttaaacatgtctgccgcactcactgccaggaaa
accagggagttccggtcaccaccgcaggagcagattaacatgcttctcaattttaaggat
gacaaaagtgaatgcccctgccctgaagaaatccgagaccaactcctagatttccacgag
gacctgatgactcactgtggaattgaactggacgaggatggatccctagatggaagcaat
gacttaacaatcagaggacgtctgttgtctctggtagaaaaggtgacctacctgaagaag
aagcaagctgaaaaaccagttgcaagtgactccagaaagtgctccagcctccagcaactc
atttctgagactatggtacggtgggctcaagagtctgtcattgaggaccctgagctggtg
agggccatgtttgtgctgctacatcggcagtatgatggcatcgggggtctagtccgagcg
ctgccaaagacctacactatcaacggggtctctgtggaggacaccatcaatctgcttgct
tcgctcggtcagatccgatctctgctgagtgtgaggatgggcaaagaagaggagaagctg
atgatccgtggactaggggatatcatgaataacaaagtgttttaccagcatcccaatctc
atgcgggcccttgggatgcatgagacagtgatggaagtcatggtgaatgtccttggaggt
ggcgagtccaaggaaatcaccttccccaagatggtggccaactgctgccgttttctctgt
tacttctgtcgtataagtagacagaatcaaaaagccatgtttgatcatctcagttactta
ctggaaaacagcagtgttggtcttgcatcaccagccatgagaggttcaactcctttagac
gtggccgcagcttcagtgatggataacaatgagcttgcccttgctctacgagagccggat
ctggagaaggtagttcgctatctggctggctgtggtctgcagagctgtcagatgctggtg
tctaagggttacccagacattgggtggaatccagttgaaggagagcgataccttgacttt
ctcagatttgcagtcttctgtaacggggagagtgtggaagagaatgcaaatgttgtggtg
aggctgctcatccggagacccgagtgctttggtcctgccttgagaggagaaggtggtaat
ggtctccttgcagccatggaagaagccataaaaatagctgaggatccttctagagatggt
ccctctccaaccagtggctccagcaaaacccttgatatagaagaggaggaagatgatacc
atccacatggggaacgcgatcatgaccttctacgcagctttgattgacctgcttggtcgc
tgtgctcctgaaatgcacttgattcatgctggaaagggagaagccatccgaattaggtcc
attttgcgatctctgattccattgggagacttggtgggcgtcatcagcattgcatttcag
atgccaacaatagccaaagatgggaaggtggtggagcctgacatgtccgcggggttttgc
ccagatcacaaggcagccatggttttgttccttgacagggtctatggaattgaggtgcaa
gatttcctcctccatctccttgaggttggctttctgccagatcttcgagctgctgcctct
ctagacacggctgcactaagtgctacagacatggccttggccctcaaccggtacctctgc
acagctgtcctacctttgttaacgaggtgtgctcccctgtttgctggaacagagcaccat
gcttccctcattgactctctgctacacactgtatatagactctctaagggatgctccctt
accaaagctcagcgggactccatagaagtgtgcctgctctctatatgtggccaactgaga
ccatctatgatgcaacacctactccgaaggctggtgtttgatgttccactgttgaatgag
catgcaaagatgcctctgaagctgctgaccaatcattatgaaagatgctggaaatattat
tgcctccctggagggtggggcaactttggtgctgcctcggaagaagaacttcatttatca
agaaaattattttggggcatctttgatgctttgtctcaaaagaaatatgaacaagaactt
ttcaaactggccctgccttgcctgagtgcagttgcgggagctttacctccagactacatg
gagtcaaactatgtcagtatgatggaaaaacagtcatccatggattctgaagggaacttt
aacccacaacctgttgatacctcaaacattacaattccagagaagttggaatacttcatt
aacaaatatgcagaacattcccatgataaatggtccatggacaagttggcgaatggatgg
atttatggggaaatatattcagactcttctaagatccaaccgctaatgaagccatataaa
ctcttgtctgaaaaggaaaaagaaatttatcgttggccaatcaaggagtctttgaaaacg
atgctggcttggggttggagaattgagagaacacgggagggggacagcatggccctttat
aaccggactcgacgaatttctcagacaagccaggtgtctatagatgctgcacatggatac
agcccccgtgctattgacatgagtaatgtgacactctctcgagacctgcatgctatggca
gagatgatggctgaaaactaccacaacatatgggccaagaaaaagaaactggagctggaa
tccaaaggaggaggaaaccaccccctcctggtgccttatgacacactgacagccaaggag
aaagccaaggacagagaaaaagcccaagacatcttcaagttcctacagatcagtggttat
gtggtatccagagggttcaaagacctggatctagatacaccttcgattgagaagcgattt
gcctatagtttcctgcagcagctgatccgatacgtggatgaggcgcatcagtacatcctg
gagtttgatggtggcagcagaagcaaaggagaacacttcccgtacgagcaagaaatcaag
ttctttgccaaagttgttcttcctttaattgatcagtatttcaaaaaccaccgcctgtac
ttcttgtctgctgcaagcaggcctctctgcactggaggacatgcatccaacaaagagaag
gagatggtgacaagcctgttctgcaaacttggagttcttgtcaggcataggatctcactg
tttgggaatgatgccacctcaattgtgaactgtctgcacattttgggtcagactttggat
gcaaggactgtgatgaagacgggcctagacagtgtgaaaagtgctcttagggcctttctg
gacaatgctgcagaggatttggaaaagacaatggaaaacctgaagcagggccagtttact
cacaccaggagccagcccaagggggtgactcagatcatcaactacaccactgtggctctc
ctgcccatgctctcctccctgtttgaacacatcggccagcatcagtttggagaagatctg
atattggaggatgtacaggtgtcttgttatagaatcctgaccagcttgtatgccctggga
accagcaagagcatctacgtggagaggcaacgatctgcacttggggaatgcttagctgcc
tttgctggtgccttccctatcgcctttttggaaacccacctggacaaacataacgtttac
tccatctacaacaccagatcttcacgagaaagagcagctctcagtttacctgcaaatgtg
gaggatgtctgcccaaatataccatccctggagaagcttatgactgagataatagagctg
gcagagtcaggaatccgctacactcagatgccatacatgatggaggttgtactgcccatg
ttatgcagctacatgtcaaggtggtgggaacacggtcctgagaaccatccagagagggct
gagatgtgctgcacagccctcaactcagagcacatgaacacgctgctgggcaacattctc
aaaatcatctacaacaacctggggattgatgaaggagcctggatgaagcgcttggccgtg
ttttcacagcctatcatcaacaaagtgaaacctcagctcttgaaaactcatttcttaccc
ttgatggagaagctaaagaaaaaggctgctatggtagtgtctgaggaagaccacctgaaa
gccgaagccagaggggacatgtctgaggccgagctgctcattctagatgagttcaccaca
ctggccagggatctctatgccttctacccactcctgatccgatttgtggactataacagg
gcaaagtggctgaaggagcccaacccagaagcagaggagctatttcgaatggtggctgaa
gtcttcatctactggtccaaatcccataatttcaaaagagaagaacagaactttgtggtg
cagaatgaaatcaacaacatgtccttcctcatcactgacacaaagtccaagatgtccaag
gcagccatttctgatcaagaaaggaagaaaatgaagcgcaaaggggaccggtattctatg
cagacatctttgatcgtggcagctctgaagagattactacccattgggctgaacatctgt
gcccctggtgaccaagagctcattgctttggccaaaaatagatttagcttgaaagacacc
gaggaggaagtacgtgatataatccgcagtaatatacacttacaaggcaagctggaagac
cctgcaatcaggtggcagatggctctctacaaagacttgccaaacaggacagaagacccc
tcagacccagagaggacagtcgagcgtgtcctgggtatagcaaatgtgctttttcacctt
gagcagaaatctaagtatactggccggggatatttcagcctggtggaacatcctcaaaga
tcaaagaaagctgtgtggcacaaactactctctaagcagagaaaaagagctgttgtggcc
tgcttccggatggcccccttgtacaatctgccaaggcatcgggcggtcaatctttttctt
cagggatatgaaaagtcttggattgaaacagaagaacattactttgaggataaattgatt
gaagatttagcgaaaccaggggctgagctcccagaagaagatgaagccatgaaaagggtt
gatcccctccatcaacttattcttctgttcagccgcacagccctaacggagaaatgcaaa
ctggaggaagattttctatacatggcgtatgcagacattatggcaaagagttgtcacgat
gaagaagatgatgatggtgaagaagaagtgaagagctttgaagaaaaggaaatggaaaag
cagaaacttctgtaccagcaagccagactgcatgaccgcggggcagcagagatggtcctg
cagactatcagtgccagcaaaggtgaaactggaccaatggtggctgctactttgaagctg
ggcattgcgattttaaatggtggcaactccacggtgcagcagaagatgctggattacctg
aaggaaaaaaaggatgtaggcttcttccagagtctggcaggcctcatgcagtcctgcagt
gtcctggacctgaatgcatttgagagacaaaacaaagcagaaggacttgggatggtgact
gaggaaggatcaggggagaaggttctgcaggatgacgagttcacctgtgacctcttccga
ttcctgcagctgctttgtgaggggcacaactcagactttcagaattacctgagaactcag
accggcaacaacaccacagttaatatcatcatctctactgtggactacctccttcgagtg
caggagtccattagtgatttctattggtactactctggcaaggacatcatagatgagcag
gggcagcgtaacttttccaaagccattcaagtggcgaagcaggtgttcaacacgctcacg
gagtacatccagggcccttgtactggaaatcagcagagcctggcacacagcaggctgtgg
gatgctgttgtgggcttccttcatgtatttgcacacatgcaaatgaagctgtctcaggat
tccagccagattgagctcttaaaagaacttatggatctccagaaggacatggtggtcatg
ctgctgtctatgctagaaggtaatgtggtgaacggaacaataggcaaacagatggtggac
atgcttgtggagtcgtccaacaacgtggagatgatcctcaagttctttgacatgtttctg
aagctgaaggacttaacatcctctgacacattcaaagagtatgaccctgatggcaaaggg
gtcatttccaagagagacttccacaaagccatggagagccacaagcactacacccagtca
gagactgagttcctgctgtcctgtgcagagacagatgaaaacgagacacttgactatgaa
gagtttgtcaagaggttccatgagcctgccaaggacatcggcttcaacgtggctgttctg
ctgaccaacctctcagagcacatgcccaatgacacgaggctgcagaccttcttggagttg
gcagagagtgtcctcaactacttccaacctttcctgggtcgcattgagatcatgggcagt
gccaagcgcatcgaaagggtctattttgagatcagcgaatccagccgaacccagtgggag
aaaccccaggttaaggagtccaagaggcagttcatattcgatgtggtcaatgagggcggg
gagaaggagaagatggagctctttgtgaacttctgtgaggacaccatctttgagatgcag
ttggcagctcagatctcagagtctgatctgaatgagaggttggctaataaagaagagagt
gagaaggagaggccagaggagcaggccccacgaatgggcttcttctccctcctcaccatc
cagtcagccctgtttgctctcaggtacaatgtcctaaccctcgtgaggatgctcagcctg
aagagcctgaagaagcagatgaagaggatgaagaagatgacagtgaaggacatggtcttg
gccttcttctcatcctactggagtgtgtttgtcaccctcttgcacttcgtggccagtgtc
tgcaggggcttctttcgcattgtctccagcctgttgctggggggcagcctggtggaaggt
gctaagaaaatcaaagtggcagaacttctagctaacatgccagaccccactcaggatgag
gtgcgaggagatgaggaggagggagagaggaagcctttagagtcagccctgccctctgaa
gacctgacagacttgaaggaactgacagaggagagtgatcttctttctgacatattcggc
ttggatctgaagagagaaggagggcagtacaaactaattcctcacaacccaaatgccggc
ctcagtgacctcatgaccaaccctgtccctgtccctgaggtacaagaaaagtttcaggag
cagaaggcgaaagaggaaaaggaagaaaaggaagaaaccaagtcggaaccagagaaagct
gaaggggaggatggagaaaaagaagaaaaagccaaagatgagaagagcaaacagaagttg
aggcagcttcatacacatcgctatggggagccggaagtgcctgagtcagcattctggaag
aaaatcatagcctaccaacagaagctgctgaactattttgctcgcaacttttacaacatg
agaatgctggccttgtttgttgccttcgccatcaatttcatcctgctcttctacaaggtc
tccacttcttctgtggttgaaggaaaggagctgcctacccgaacctccagcgatactgct
aaagtgaccaacagcctagacagcagcccccacaggatcattgcggttcactatgtcctg
gaggagagcagcggctacatggaacccaccctgcgcatcttagccatcctccacaccatc
atctccttcttttgcatcatcggatactactgcttgaaagtccccttggttatttttaag
cgagagaaggaagtggcacggaagttggagtttgacggactttatataacagagcagcca
tcggaagatgatatcaaaggccagtgggacagacttgtgatcaacacacagtcatttccc
aataactactgggataaatttgtgaaaagaaaggtaatggataaatatggagagttttat
gggagagacagaatcagtgagttactgggcatggataaggctgcactagatttcagcgat
gcaagagagaagaagaagcccaagaaagacagctccttgtctgctgtattgaattctatt
gacgtgaagtaccagatgtggaaacttggagtcgtgttcacagacaattccttcctctac
ctagcctggtacatgaccatgtctgttcttggacattataacaactttttttttgctgct
cacctccttgacatcgcgatgggattcaagaccttgagaactatcctgtcctcagttacc
cataatggcaaacagctcgtgttaactgttggcttattggctgttgttgtgtacctgtac
actgtcgtggcgttcaatttcttccgaaaattctacaataaaagtgaggatggtgacacg
ccagacatgaagtgtgatgacatgctgacgtgttacatgttccacatgtatgtgggcgtc
cgtgctggagggggcattggtgatgaaattgaagacccagcaggagacgagtatgagatc
taccgcatcatctttgacatcacattcttcttcttcgtgattgtcatccttttggctatc
atacaaggtttgatcattgatgcttttggagaactcagagaccaacaagagcaagtcaag
gaagacatggagaccaagtgcttcatctgtgggattggcaacgattattttgatacagtg
ccacatggctttgaaacccatactttacaggaacacaacctggccaactacctgtttttt
ctgatgtatctcataaacaaggatgaaacagaacacacaggacaggaatcttacgtctgg
aagatgtaccaagagaggtgttgggaatttttcccagcaggggactgtttccggaaacag
tatgaagaccagttaaattag

KEGG   Mus musculus (mouse): 20192
Entry
20192             CDS       T01002                                 

Gene name
Ryr3, AI851294, C230090H21, RYR-3
Definition
(RefSeq) ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04921  Oxytocin signaling pathway
mmu04970  Salivary secretion
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20192 (Ryr3)
   04020 Calcium signaling pathway
    20192 (Ryr3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    20192 (Ryr3)
  09154 Digestive system
   04970 Salivary secretion
    20192 (Ryr3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    20192 (Ryr3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    20192 (Ryr3)
   05012 Parkinson disease
    20192 (Ryr3)
   05020 Prion disease
    20192 (Ryr3)
   05022 Pathways of neurodegeneration - multiple diseases
    20192 (Ryr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    20192 (Ryr3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ryanodine receptor
   20192 (Ryr3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 20192
NCBI-ProteinID: NP_001306085
MGI: 99684
Ensembl: ENSMUSG00000057378
Vega: OTTMUSG00000015132
UniProt: A0A140LJK7
Position
2; 2 E3- E4
AA seq 4868 aa
MAEAGEGGEDEIQFLRTEDEVVLQCIANIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTVENGGEGAAQGGGHRTLLYGHAILLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSISNGSIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRVFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLLLQDRGKSDTKSTAFSFRASKEIKEKLDSSHKRDMEGMGVPEIKYGDSVCFVQHVAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQQEESQAARIIRNTTALFSQ
FVSGNNRTTAPVALPTEEVLQTLQDLIAYFQPPEDEMQHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIVREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILIESPEALNLIAEGHIKSIISLLDKHGRNHKVLDV
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSPQYKKW
YFELIIDQVEPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLKSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGVRDLLGT
TQFLSQASFIPCPIDTSQVVLPLHLEKIRDRLAENIHELWGMNKIELGWTYGKVRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADPTVEKVSIDKIRFFRVERSY
AVKSGKWYFEFEVVTGGDMRVGWARPGCRPDIELGADDQAFVFEGSRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMVFTLNGELLITNKGSELAFADYEIENGFVPICSLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAVWFSKRLPTFVNVPKDHPHIEVVRID
GTMDSPPCLKVTHKTFGTQNSNANMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQRSSRSNVDLEIGCLLDLAMGMLSFSANGKELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFKSEEKNPTPQCPPRLDVQTIQPVLW
SRMPSSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMQFHYH
TLRLYSAVCALGNSRVASALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLANAKE
RKLMMKNEYIIPITSATRNIRLYPDESKRHGLPGVGLRTCLKPGFRFSTPCFVVTSEDHQ
KQSPEIPLQILKTKALSMLTEAVHCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSGETEEGVEKEVTHAEEKAVEAGEKACKEAPVKGLLQTRLPE
SVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTAR
KTREFRSPPQEQINMLLNFHLGENCPCPEEIREELYDFHEDLLVHCGVPLEEEEEEEEDT
SWTGKLCALVYKIKGPPKPEKEQPTEEEKPYPTTLKELVSQTMIRWAQENQIQDAELVRM
MFNLLRRQYDSIGELLQALRKTYTISQASVNDTINLLAALGQIRSLLSVRMGREEELLMI
NGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIAFPKMVASCCRFLCYFC
RISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLEK
VVTYLAGCGLQSCPMLLARGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLL
IRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKTEVTQDDGEEEEIVHMG
NAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPSL
NKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDTV
SLSTTEAALALNRYLCSAVLPLLTRCAPLFSGTEHCTSLIDSTLQTIYRLSKGRSLTKAQ
RDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLSEYCKMPLKLLTNHYEQCWKYYCLPS
GWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDLDLFRMALPCLSAIAGALPPDYLDTRI
TATLEKQVSVDADGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSHSGWKYGI
SLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRENE
KLRCVSQTNQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGGS
HPLLVPYDTLTAKEKFRDREKAQDLFKFLQVNGILVSRGMKDLELDASSMEKRFAYKFLK
KILKYVDAAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLSSP
LKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTVM
KSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILT
SIFEHIAQHQFGVDLLLSDVQVSCYHILCSLYSLGTGKNIYVERQRPALGECLASLAAAI
PVAFLEPSLNRHNPLSVFNTKTPRERSILGMPDKVEDMCPDIPQLEGLMKEINDLAESGA
RYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSTGPCCTKVTSEHLSLILGNILKIINN
NLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKTDGKG
DTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDPDSDQLFRMVAEVFILW
CKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLYSI
QTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSCRDTDEEVKEHLRNNLHLQEKSDD
PAVKWQLNLYKDVLRNDEPSNPEKTVERVQSISAALFHLEQVEQPLRSKKAVWHKLLSKQ
RKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEAHFFEEKLVQDLAKSPRVEDEE
EEETERQPDPLHQIILHFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEEEDKEK
TFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNAG
VQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRERG
EKVLQNDEFTQDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNIIISTVDYLLRLQESIS
DFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVG
FLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVES
STNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISRKEFQKAMEGLKQYTQSEIDFL
LSCTEADENDMFNYVDFVERFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKSLLDPAESVL
NYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKM
ELFVNFCEDTIFEMQLASQISESDSTDRPEEEEEEDEDSAYSIETEGEEEEKSFESASAF
TMACVSVKRNVTKFLKRATLKNLRKQYRNVKKMSAKELVKVFFSFFWMLFVGLFQLLFTI
FGGIFQILWNTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDVIETDRAEVTEPGVTT
ELVHFVKGEAGDTDIMSDLFGIHSKKEGGLKQGPEVGLGDLSEIIGKDEPPTLESTVRKK
RKAQAAEMKAVHEAEGKAESEKADMEDREKEDKIKEEGQTDYLWADVTVKKTRRRGQKAE
KPEAFMANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEET
EDVANLWNSFNDDDEEEAMVFFVLQESTGYMAPTLRALAIVHTIISLVCVVGYYCLKVPL
VVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKY
GDLYGAERIAELLGLDKNALDFSPVEEAKAEAASLVSWLSSIDMKYHIWKLGVVFTDNSF
LYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVY
LYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPY
EMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFD
TTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFR
KQYEDQLG
NT seq 14607 nt   +upstreamnt  +downstreamnt
atggccgaagcgggagaaggaggcgaggatgagatccagttcctgaggactgaggatgaa
gttgtactccagtgcattgcaaacattcacaaggagcagcggaagttctgcctggcagcc
gagggacttgggaatcgcctgtgcttcttggaacccacctcagaagccaagtacattcct
ccagatctctgtgtctgcaatttcgtgctggaacagtccttatctgtcagagcactgcaa
gaaatgcttgccaacaccgttgaaaatggcggagaaggggcggcacaagggggtggccac
aggaccctgctctacgggcatgcaattctcctgcggcactctttcagtggaatgtatcta
acgtgcttgaccacgtcaagatcccagacagataaacttgcctttgatgtaggtctgcgg
gaacatgccacaggagaagcctgttggtggactatacatcctgcttccaaacaaaggtct
gaaggagagaaagtacgaattggagatgaccttatcctcgtcagtgtgtcctctgaaaga
tatcttcatctctcgatatcaaatggtagcatccaagtggatgcctcctttatgcaaaca
ctctggaacgtacatcctacctgctcaggaagtagcattgaagaaggatacttactcggt
ggccatgtagttcgtcttttccacggtcatgatgaatgtttgacgataccatctacagat
cagaatgattctcagcacaggagggtgttctatgaagctggaggagctgggaccagagcc
aggtctctatggagagtggaaccccttcggataagctggagtggcagtaacatcaggtgg
ggccaggccttccgactccggcatcttaccacaggccactacttggccttgacagaagac
caaggccttcttctacaagaccggggaaaatccgacaccaaatccacagccttctccttc
cgagcatcaaaggaaatcaaggagaaattagattccagtcacaaaagagatatggaaggc
atgggagttccagaaatcaagtacggggattctgtctgctttgttcagcatgtagccagt
ggcctttgggtcacctacaaagcacaagatgccaaaacttcccgcctgggacctctgaaa
agaaaggtcatactccatcaggaaggccacatggatgacggattaacactgcagaggtgc
cagcaggaagagtcccaggctgctcgcatcatccggaacacaaccgccttattcagccag
tttgtcagtggaaacaatcgcacaactgcccctgtcgccttgccaacagaagaggttctg
cagaccctgcaagacttgatagcctacttccagccaccagaggacgagatgcaacatgaa
gacaaacagaataagctccgctctctaaagaacagacaaaatcttttcaaggaggagggg
atgctggccctcgtattgaattgcattgatcgattaaacatctacaatagtgtagcacac
tttgcagggatcgtaagggaagagagtggcatggcctggaaagaaattctgaacctgcta
tacaaattactagccgctctcatacgtggaaacagaaacaattgtgctcaattctccaat
aaccttgattggttaattagtaagttggacagactagaatcttcctcaggtatcttggag
gtcttgcactgcatcttgattgaaagcccagaagccttaaacctaatagcagagggccac
atcaagtctatcatctccctactggataagcatgggcggaatcacaaggttctcgatgtc
ctgtgctccctctgtctctgcaatggggttgcagtaagagccaaccagaatctgatctgt
gacaacctactaccccggaggaacctgcttctgcagacacgactaattaatgatgtcacc
agcatccggccaaacatcttcctgggagttgctgaaggttcaccacagtacaagaagtgg
tactttgagttaattatcgaccaggtggagcctttcctaacagcagagcctacacatctg
cgagtgggctgggcctcctcttcaggctatgccccgtaccctggtggtggagaaggatgg
ggaggcaatggtgtcggtgatgatctgtactcctatggctttgatgggcttcatctgtgg
tcaggacggatacccagagctgtggcttccatcaaccagcatctgctcaagtcagacgat
gtggtgagctgctgccttgaccttggagtacccagcatttctttccgaatcaatggacaa
cctgtgcaggggatgtttgagaatttcaacacagatggactcttcttccctgtgatgagt
ttttcagctggtgtcaaagtacgcttcctgatgggtggtcggcatggagaatttaagttc
ctgcctccctcaggctatgccccttgctatgaagccttacttcctaaggagaagatgaga
ttggagcctgtcaaagaatataagcgtgatgctgatggtgtgagagatctattgggtacc
acacagttcctctcccaagcctctttcatcccatgtcccatagataccagtcaggttgtt
ttgccacttcacctagagaagatccgagacagactggctgagaacatccacgagctttgg
gggatgaacaaaatagaactcggctggacttatggcaaagtgcgggatgacaacaaaagg
cagcatccctgccttgtggagttttcaaagctccctgaaactgagaagaattataacctg
cagatgtcaacggaaaccttgaaaaccttgctggccctggggtgccacattgctcatgtt
aacccagctgcggaagaggatctaaagaaagtcaagcttcccaaaaactatatgatgtcc
aatggctataagccagcccctttggatttatctgatgtgaagctgttaccacctcaagaa
attttagtggataagcttgcagaaaatgctcacaatgtttgggcaaaggacagaattaaa
caaggttggacctatggtattcaacaggatctgaagaataaaagaaatccccgcctggtg
ccatatgcattactagatgagcgcaccaagaaatcaaacagggacagcctacgtgaagct
gtacggacatttgttggttatgggtataacattgagccttcagaccaagaactagctgat
cctactgtcgagaaggtcagcatagacaagatccggtttttccgagtagaacggtcatat
gctgtaaagtctggaaagtggtactttgaatttgaagtggtaactggaggagacatgcgt
gttggctgggccaggccaggctgtcgtcctgacattgagctgggggctgatgatcaagcc
ttcgtgtttgaaggaagcaggggtcagcgttggcatcaaggcagtgggtattttggacga
acttggcagccaggagatgtggtcgggtgcatgattaacctggatgatgcctccatggtc
ttcacactgaatggggaactgctcatcaccaacaaaggttctgaacttgccttcgcagac
tatgagattgagaacggttttgtgcccatttgctctctggggctatcccagattggccgc
atgaatcttgggacagatgccagtaccttcaagttttataccatgtgtggactccaggag
ggctttgagccttttgcggtaaatatgaaccgagatgttgcagtgtggtttagcaagcgc
ctcccaacatttgtgaatgtgcctaaggatcatccccacatagaggttgtgagaattgat
ggcaccatggacagccctccatgcctcaaggtgacccacaagaccttcggcacacagaac
agcaatgccaacatgatctactgccgcctgagcatgcctgttgaatgtcattcctctttc
agtcacagtccctgtctagacagtgaagccttccaaaaaaggaaacagatgcaagaaata
ctatctcacacaacaacacaatgctactatgctatccgcatttttgctgggcaggaccca
tcatgtgtctgggttggatgggtgactccggactaccatttatacagtgaaaagtttgac
ctgaataaaaactgcactgtgactgtcaccctgggagatgaaagaggccgggtccatgaa
agtgtgaaacgcagcaactgctacatggtctggggtggggatattgtagccagttcccaa
agatcaagtcggagcaatgtagacctggagattggctgccttctagatctggcaatgggc
atgttgtccttctcagctaatgggaaggaacttggcacctgctaccaggtggagcctaac
accaaagtgttccctgcagtcttccttcagcctaccagcacgtccttgtttcagtttgaa
cttggaaaactgaagaatgcaatgcctctgtcagcagccatatttaagagtgaagagaag
aaccccaccccacagtgtccacctcggctggatgtccaaaccatccagcctgtactctgg
agtcgaatgcccagcagcttcctcaaagtggagacagagcgggtgagcgagcgccatggc
tgggtggtgcagtgcctagaacccctgcagatgatggcactccacatccctgaggagaac
aggtgtgtggacatcctcgagctctgtgagcaggaggacctgatgcagttccattaccac
acactgagactttacagcgctgtgtgcgctctgggaaatagccgagtggcttctgccctg
tgcagccacgtggacctctcacagctcttctacgccattgacaacaagtacttgcctggc
ctccttcggtctggcttctatgacctgctcattagcatccacctggccaatgctaaggag
aggaagctgatgatgaagaatgagtacatcattcctatcaccagcgccaccaggaatatc
cgcctatacccggatgagtccaagagacacggattgcctggggtgggcctgaggacatgc
ctcaagccaggcttcaggttctccaccccttgctttgtggtgacgagtgaggaccatcag
aagcagagccctgagattcccttgcagattctcaagacaaaagccctgagcatgctaacc
gaggccgtgcactgtagcggggcccacatccgagaccctgtcgggggttctgtggagttc
cagttcgtgcctgtgctgaaactcattggaaccttgttagtcatgggggttttcgacgac
gatgatgttcgccagattctcctcctgattgatccctctgtgtttggggagcacagtggg
gagacggaagaaggggtggaaaaagaagtgacccacgcagaggaaaaggcagtggaggct
ggagaaaaggcctgcaaggaggctccagtcaaaggcttgctgcagacccgattgcctgag
tctgtcaagctgcagatgtgcgaactcctcagctacctctgtgactgcgaactgcagcac
cgagtagaggctattgtggcatttggtgacatttacgtgtccaagctgcaggcaaatcag
aagttccgctacaatgagctcatgcaggccctgaacatgtctgcagccctaactgccaga
aagacaagagagttccgctcaccgccccaggagcagatcaacatgcttctcaactttcac
ctgggagagaactgcccctgcccagaggagatccgagaggagctgtatgacttccatgag
gaccttctggttcactgcggggttcccttggaggaagaggaagaggaggaggaggatact
tcctggacaggaaaactgtgtgctctggtgtataagatcaagggtccacccaagcctgag
aaggagcagccaacagaggaagagaaaccgtatcctacaacactgaaggaactagtttca
cagacaatgatccgctgggcccaggagaaccaaatccaggatgcggaactggtgaggatg
atgttcaacctccttcggagacagtatgacagcattggggagttgctccaggctctgcgg
aagacctacaccatcagccaggcctctgtgaatgacactatcaacctgctggctgccctg
ggccagattcggtccctgcttagtgtcaggatgggcagagaagaggagctcctcatgatc
aacgggctaggggacataatgaacaacaaggtgttttaccagcaccccaacctgatgaga
gtcctcggcatgcatgagactgtgatggaagtgatggtcaatgtgctgggtactgagaag
tcgcagattgccttcccaaagatggttgctagctgctgtcgcttcctttgctatttctgt
cgaattagccggcaaaatcagaaggccatgtttgagcatctaagttacctgctggagaac
agtagtgtgggtctagcgtccccatcgatgagggggtccaccccactggatgtggcagcc
tcctctgtgatggacaataatgaactagcactgggcttagaagaaccggatcttgagaag
gtcgtaacctacttggcaggctgtggccttcagagctgccccatgcttctggccagaggc
taccctgacgttggctggaaccccatcgaaggggagcgctacctgtccttcctgaggttt
gccgtcttcgtaaacagcgaaagtgtggaagaaaatgccagcgttgtggtcaaactgctc
atcagacgtcccgagtgcttcggcccagctctgaggggtgaaggaggcaacggactgctg
gcggctatgcagggtgctattaagatctcagagaaccctgccctcgacctcccttcccag
ggttacaagacagaagtcacacaggatgatggagaggaggaagagattgtgcatatgggc
aatgcaattatgtcattttattcagcgcttatagatctattgggccgctgtgctcccgaa
atgcatctcatccaaacagggaaaggggaagccatccggatccggtccatcctgcgctcc
ctggtccccacggaagacctggttgggatcatcagcatccccctcaaactgccctcccta
aacaaagatggttcagtcagcgagccagacatggcggccaacttctgccctgaccacaag
gcacccatggtgctgttcttggaccgtgtttatggcattaaagatcaaactttcctgctc
cacttgctggaagttgggtttttacctgacttacgggcttctgcatctctagatacagtg
tccctcagcaccacagaggctgcgctggcgctgaataggtatttatgttcggctgtgctc
ccactcctcactagatgcgcccctctcttttctgggacagaacactgtacttctctgatt
gattctacactgcagacaatatacaggctttccaaaggacgctccctcaccaaggcacag
agggacaccatagaagaatgtttgctagccatttgcaatcatttgagaccttccatgtta
cagcaactcctgcgtcgtctggtttttgacgtgccacagctcagcgagtactgcaagatg
ccccttaagcttctgacaaatcactacgagcagtgctggaagtattactgcctgccttcg
ggatgggggagctatgggctggctgtggaggaggagctgcacctcactgagaagctcttc
tgggggatctttgactccctctcccacaagaaatatgacctggaccttttccgaatggcc
ctgccttgtctcagtgctattgctggggccttgccaccagactatttagatacgagaatt
acagccacattggagaagcaggtctcagtggatgcagatggaaactttgaccccaaacct
atcaacaccatgaatttttccttgcctgaaaaattggaatacattgtcaccaagtatgct
gagcattctcatgataaatgggcttgtgacaagagtcacagtggatggaaatatgggatt
tctctggatgaaaatgtgaagacacacccactaatacggcccttcaagacattaacagag
aaggagaaggaaatttatcgctggcctgccagagagtccctgaaaaccatgctggctgtg
ggctggacagtggaaaggaccaaagaaggagaagccttggttcaacaaagagagaatgag
aagcttcgatgtgtgtcccagaccaatcagggcaatagttacagccccgcccctctggat
ctctcaaatgttgtgctgtccagggagcttcagggaatggtggaggtggtggctgagaac
tatcacaatatctgggccaagaagaagaagctggagctggaaagcaagggtggtggcagc
cacccgcttttggtaccatatgacaccttgactgccaaggaaaagttcagggatcgagag
aaggcccaggacctgttcaaattcctccaagtgaatggcattctagtttctagaggcatg
aaggacttggagctggatgcctcctccatggagaagagatttgcctacaagtttttgaag
aagatcctgaagtatgttgacgctgctcaagagtttattgctcacttggaagccattgtc
agcagtgggaagacagaaaagtctccccatgaccaggagatcaaattctttgccaaagtt
ctcctcccactggtcgaccagtacttcaccaaccaccgcctgtatttcctgtcgtctcct
ctgaagccgctcagcagcagtgggtatgcttcccataaagagaaagaaatggtggccagc
ctattctgcaagctggccgctcttgttagacacaggatttcactctttgggagcgattca
actacaatggtgagctgtcttcatatcttagctcagacacttgacacaaggacagtgatg
aagtcaggctcagagctggtgaaagccgggctgcgagcattctttgaaaatgctgctgaa
gacttagagaagacctccgaaaacctgaagctggggaagtttacccattcccgaacgcag
atcaaaggtgtttctcagaatattaactacaccacagtggctctgcttcccatcctgaca
tccatctttgagcacatcgctcagcatcagtttggggtggatctactcttgagcgacgtg
caggtttcatgctaccacattctgtgcagcctctactcccttgggactgggaaaaacatc
tatgttgaaaggcaacgtcctgctcttggagaatgtctggcttccctagcagctgctatc
cctgtggcctttctggagcccagccttaaccgccacaatcccctctcagtcttcaacacc
aaaacccccagggagcgctctattctggggatgccagacaaggtggaggacatgtgtcct
gacatccctcagctggaaggcctgatgaaggaaatcaatgacttggccgagtcaggtgcc
cggtacactgagatgccccatgtcattgaagtgatcttgcccatgctctgcaactacctg
tcctactggtgggagcggggacctgagaacctgccccccagcacaggaccctgctgcacc
aaggtcacatctgaacacctcagcctcatcctgggcaacatcctgaaaatcatcaacaac
aacctgggcattgatgaggcctcctggatgaagcgcatcgcagtgtatgcccagccaatt
atcagcaaagccaggcccgacctgcttcgaagccacttcatccccaccctggagaagcta
aagaagaaggcggtgaagactgtgcaggaggaggagcagctgaagaccgatggcaagggg
gacacccaggaggctgagctcctcatcctagatgagtttgctgtcctctgcagggacctc
tatgccttctaccccatgctgatccgctatgtggacaacaacagatctaactggctcaaa
agcccagatcctgattctgaccagctcttccgcatggtggccgaggtcttcattctgtgg
tgtaaatctcataacttcaagagggaagagcaaaattttgtgattcaaaatgaaattaat
aacttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaagtaaag
tctggaggacaggaccaggaacggaagaagacaaagaggcgaggagacttgtattccatc
cagacgtcccttatcgtggctgcgctcaagaaaatgctgcccattggtctgaacatgtgt
actccaggcgaccaggagctcatctcactcgcaaaatcacgatacagctgtagggacact
gatgaagaagtcaaggaacatcttcggaataacctgcacctgcaggagaagtctgatgac
ccagctgtgaaatggcaactgaacctctacaaggacgttctgaggaatgacgagccttct
aatccagaaaagacggtggagcgggtgcagagcatttcggcagctctcttccaccttgag
caggtggaacagcctttgaggtccaaaaaggctgtatggcacaaattgttgtcaaagcaa
cggaaacgggcagtggtggcctgtttcaggatggctcccctctacaatctgcccaggcac
cgctctattaacctcttcctccatggctatcagagattctggatagaaacagaggcgcat
ttctttgaagagaaactagtacaggatctggctaaatctcccagggttgaagatgaggaa
gaagaggagacagagaggcaacctgacccacttcaccagatcattctgcattttagtcgc
aacgcgctcacggagaggagcaaattggaagatgatccattgtacacttcctattccagc
atgatggccaagagctgtcagagtggtgaggatgaagaagaagaagaagacaaggaaaaa
acctttgaagagaaggagatggagaagcaaaaaacactgtatcaacaagcaaggctgcac
gagcgtggtgctgcagagatggtccttcagatgataagtgccagcaaaggtgagatgagc
cccatggtggttgagacactgaagctggggattgccattctgaacggaggcaatgctggt
gtgcaacagaaaatgctagattacttaaaggagaaaaaagatgctggattctttcaaagc
ctctctggtcttatgcagtcctgcagtgtccttgatttgaatgcatttgagagacagaat
aaagctgaaggcctggggatggttacagaagaagggacactcattgttcgtgagcgtggt
gaaaaggtactccagaatgatgaattcacacaagatctctttagattcctacagttgctt
tgtgaaggacataacagtgactttcagaacttcctgaggactcagatgggcaacaccact
actgtgaacatcatcattagcactgtggactaccttctgcgtctgcaggaatcaatcagc
gatttctattggtactattcaggaaaggacatcattgatgaatctggacagcataatttc
tctaaagctctggcagtcaccaagcaaatttttaattctcttacagagtacatccagggc
ccttgcatcgggaaccagcaaagcctggctcacagtaggctgtgggatgcagtagtcggg
ttcctccatgtatttgctaacatgcagatgaagctttctcaggattccagtcagatcgag
ctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtccctcctg
gaaggaaatgtggtaaatgggactatcggaaagcagatggttgacacgctggtagaatca
tccactaatgtagagatgatcttgaaattctttgacatgtttttgaaacttaaagactta
accagctcagacaccttcaaagaatatgacccagatggcaaagggatcatctctcgaaaa
gaatttcagaaggccatggaaggtctaaagcaatatacacagtcagagatcgactttctc
ctttcatgtacagaggctgatgagaacgacatgtttaattatgtggattttgtagagagg
ttccatgagccagccaaggacatagggttcaatgtggcagtgttattgacaaatctctct
gaacatatgcccaacgattcccgtctcaagagtctgttggacccagcagaaagtgtgcta
aattacttcgagccatacctgggtcgaattgagatcatgggtggggccaagaaaattgag
cgtgtttattttgagatcagtgaatccagtcgaactcagtgggaaaaacctcaagtgaag
gaatctaagcgacagttcatcttcgatgttgtcaatgaaggcggggagcaagagaagatg
gaattgtttgtgaacttctgtgaggatacaatctttgagatgcaattagcatctcagatc
tcagaatctgactcaactgacaggccggaagaggaagaggaagaggatgaagactctgct
tattctatagaaaccgagggggaggaggaagagaaatcttttgagtctgcctctgctttt
actatggcctgtgtctcagtaaagagaaatgtcaccaagtttctgaagagggcaaccttg
aagaacctcaggaaacaatacaggaatgtaaaaaagatgagtgcaaaggaactggtcaag
gtgttcttctccttcttctggatgctgtttgtgggcctctttcagttgctcttcacaatc
tttggaggaatctttcagatcctctggaacacagtgtttggagggggccttgtcgaaggg
gcaaagaacatcagagtgactaagatcctaggtgacatgcccgaccccactcagtttggg
atccatgatgatgtaatagaaactgacagggcagaagtgactgagccaggtgtcaccact
gagctggtccactttgtaaagggtgaggcaggagatacagacatcatgtcagacctcttt
ggaatccactccaagaaagaaggtggcttaaagcaagggcctgaagtgggattaggtgac
ctctctgaaattatcggcaaggacgaacccccaacattagagagtactgtgcggaagaaa
agaaaagcacaggcagcagagatgaaagcagtgcatgaagctgaaggaaaagctgaatct
gagaaggccgacatggaagacagagaaaaggaagacaaaatcaaggaggaggggcaaaca
gactacctgtgggcagacgtgacagtaaagaagacgagacggcgcggtcagaaggctgag
aagccagaagcctttatggccaacttcttcaaagggctggagatttatcagaccaagtta
ttgcactacctggccaggaatttctacaacctgaggttccttgctctgtttgtagccttc
gctatcaacttcatcctgcttttttataaggtcactgaagaacctttagaggaagagaca
gaggatgttgcaaacctgtggaactcattcaatgatgatgacgaggaagaagcgatggtg
ttctttgttcttcaggagagcactggttatatggcaccaacactgcgtgctttggccatt
gtccacaccatcatctctctggtctgtgtggtgggctattactgcctgaaggtacctttg
gtggtattcaaaagggagaaagaaattgccaggaagctggagtttgatggcctctatatc
actgaacagccatctgaggatgacatcaaggggcagtgggaccgcttggtaatcaacacg
ccatcttttcctaataactactgggacaagtttgtgaagagaaaggtgatcaacaagtat
ggagatctctatggagcagagcgcatcgctgaactcctgggtttggacaaaaatgccctt
gactttagcccagtagaagaggccaaagcagaggcagcatctctggtgtcatggctaagt
tccatcgacatgaagtaccatatttggaagctaggggtggttttcactgacaactccttt
ctctaccttgcctggtacacaaccatgtctgtcctgggccactacaacaacttcttcttt
gctgctcatctgttggatattgcaatgggctttaagaccttgaggacgatcctgtcatct
gtaactcacaatggcaaacagctggttctgaccgttggcctcctggctgtggttgtttac
ctctatactgtggtggctttcaacttcttccgaaagttctacaacaaaagtgaagatgac
gatgagccggatatgaagtgtgacgacatgatgacgtgctacctcttccacatgtacgtg
ggcgtaagagcaggtggaggcattggtgatgaaattgaagaccccgctggtgacccttat
gaaatgtatcgcatcgtctttgatattaccttcttcttcttcgtcattgtcatcttgctg
gccatcattcaaggtcttattattgatgcttttggagagctgcgggaccagcaggagcaa
gtacgggaagacatggagaccaagtgcttcatctgcggcattggcaatgactactttgac
acgacccctcatggttttgaaacacatacactgcaagagcacaacttagccaattatcta
ttctttctgatgtatttgattaacaaggatgaaacagaacatacgggccaggaatcctat
gtgtggaagatgtaccaggaaaggtgttgggacttcttcccagctggagactgctttcgg
aagcaatatgaagatcagctcgggtaa

DBGET integrated database retrieval system