KEGG   Mus musculus (mouse): 20192
Entry
20192             CDS       T01002                                 

Gene name
Ryr3, AI851294, C230090H21, RYR-3
Definition
(RefSeq) ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04921  Oxytocin signaling pathway
mmu04970  Salivary secretion
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20192 (Ryr3)
   04020 Calcium signaling pathway
    20192 (Ryr3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    20192 (Ryr3)
  09154 Digestive system
   04970 Salivary secretion
    20192 (Ryr3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    20192 (Ryr3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    20192 (Ryr3)
   05012 Parkinson disease
    20192 (Ryr3)
   05020 Prion disease
    20192 (Ryr3)
   05022 Pathways of neurodegeneration - multiple diseases
    20192 (Ryr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    20192 (Ryr3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ryanodine receptor
   20192 (Ryr3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 20192
NCBI-ProteinID: NP_001306085
MGI: 99684
Ensembl: ENSMUSG00000057378
Vega: OTTMUSG00000015132
UniProt: A0A140LJK7
Position
2; 2 E3- E4
AA seq 4868 aa
MAEAGEGGEDEIQFLRTEDEVVLQCIANIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTVENGGEGAAQGGGHRTLLYGHAILLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSISNGSIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRVFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLLLQDRGKSDTKSTAFSFRASKEIKEKLDSSHKRDMEGMGVPEIKYGDSVCFVQHVAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQQEESQAARIIRNTTALFSQ
FVSGNNRTTAPVALPTEEVLQTLQDLIAYFQPPEDEMQHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIVREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILIESPEALNLIAEGHIKSIISLLDKHGRNHKVLDV
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSPQYKKW
YFELIIDQVEPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLKSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGVRDLLGT
TQFLSQASFIPCPIDTSQVVLPLHLEKIRDRLAENIHELWGMNKIELGWTYGKVRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADPTVEKVSIDKIRFFRVERSY
AVKSGKWYFEFEVVTGGDMRVGWARPGCRPDIELGADDQAFVFEGSRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMVFTLNGELLITNKGSELAFADYEIENGFVPICSLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAVWFSKRLPTFVNVPKDHPHIEVVRID
GTMDSPPCLKVTHKTFGTQNSNANMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQRSSRSNVDLEIGCLLDLAMGMLSFSANGKELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFKSEEKNPTPQCPPRLDVQTIQPVLW
SRMPSSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMQFHYH
TLRLYSAVCALGNSRVASALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLANAKE
RKLMMKNEYIIPITSATRNIRLYPDESKRHGLPGVGLRTCLKPGFRFSTPCFVVTSEDHQ
KQSPEIPLQILKTKALSMLTEAVHCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSGETEEGVEKEVTHAEEKAVEAGEKACKEAPVKGLLQTRLPE
SVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTAR
KTREFRSPPQEQINMLLNFHLGENCPCPEEIREELYDFHEDLLVHCGVPLEEEEEEEEDT
SWTGKLCALVYKIKGPPKPEKEQPTEEEKPYPTTLKELVSQTMIRWAQENQIQDAELVRM
MFNLLRRQYDSIGELLQALRKTYTISQASVNDTINLLAALGQIRSLLSVRMGREEELLMI
NGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIAFPKMVASCCRFLCYFC
RISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLEK
VVTYLAGCGLQSCPMLLARGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLL
IRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKTEVTQDDGEEEEIVHMG
NAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPSL
NKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDTV
SLSTTEAALALNRYLCSAVLPLLTRCAPLFSGTEHCTSLIDSTLQTIYRLSKGRSLTKAQ
RDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLSEYCKMPLKLLTNHYEQCWKYYCLPS
GWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDLDLFRMALPCLSAIAGALPPDYLDTRI
TATLEKQVSVDADGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSHSGWKYGI
SLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRENE
KLRCVSQTNQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGGS
HPLLVPYDTLTAKEKFRDREKAQDLFKFLQVNGILVSRGMKDLELDASSMEKRFAYKFLK
KILKYVDAAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLSSP
LKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTVM
KSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILT
SIFEHIAQHQFGVDLLLSDVQVSCYHILCSLYSLGTGKNIYVERQRPALGECLASLAAAI
PVAFLEPSLNRHNPLSVFNTKTPRERSILGMPDKVEDMCPDIPQLEGLMKEINDLAESGA
RYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSTGPCCTKVTSEHLSLILGNILKIINN
NLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKTDGKG
DTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDPDSDQLFRMVAEVFILW
CKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLYSI
QTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSCRDTDEEVKEHLRNNLHLQEKSDD
PAVKWQLNLYKDVLRNDEPSNPEKTVERVQSISAALFHLEQVEQPLRSKKAVWHKLLSKQ
RKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEAHFFEEKLVQDLAKSPRVEDEE
EEETERQPDPLHQIILHFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEEEDKEK
TFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNAG
VQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRERG
EKVLQNDEFTQDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNIIISTVDYLLRLQESIS
DFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVG
FLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVES
STNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISRKEFQKAMEGLKQYTQSEIDFL
LSCTEADENDMFNYVDFVERFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKSLLDPAESVL
NYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKM
ELFVNFCEDTIFEMQLASQISESDSTDRPEEEEEEDEDSAYSIETEGEEEEKSFESASAF
TMACVSVKRNVTKFLKRATLKNLRKQYRNVKKMSAKELVKVFFSFFWMLFVGLFQLLFTI
FGGIFQILWNTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDVIETDRAEVTEPGVTT
ELVHFVKGEAGDTDIMSDLFGIHSKKEGGLKQGPEVGLGDLSEIIGKDEPPTLESTVRKK
RKAQAAEMKAVHEAEGKAESEKADMEDREKEDKIKEEGQTDYLWADVTVKKTRRRGQKAE
KPEAFMANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEET
EDVANLWNSFNDDDEEEAMVFFVLQESTGYMAPTLRALAIVHTIISLVCVVGYYCLKVPL
VVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKY
GDLYGAERIAELLGLDKNALDFSPVEEAKAEAASLVSWLSSIDMKYHIWKLGVVFTDNSF
LYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVY
LYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPY
EMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFD
TTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFR
KQYEDQLG
NT seq 14607 nt   +upstreamnt  +downstreamnt
atggccgaagcgggagaaggaggcgaggatgagatccagttcctgaggactgaggatgaa
gttgtactccagtgcattgcaaacattcacaaggagcagcggaagttctgcctggcagcc
gagggacttgggaatcgcctgtgcttcttggaacccacctcagaagccaagtacattcct
ccagatctctgtgtctgcaatttcgtgctggaacagtccttatctgtcagagcactgcaa
gaaatgcttgccaacaccgttgaaaatggcggagaaggggcggcacaagggggtggccac
aggaccctgctctacgggcatgcaattctcctgcggcactctttcagtggaatgtatcta
acgtgcttgaccacgtcaagatcccagacagataaacttgcctttgatgtaggtctgcgg
gaacatgccacaggagaagcctgttggtggactatacatcctgcttccaaacaaaggtct
gaaggagagaaagtacgaattggagatgaccttatcctcgtcagtgtgtcctctgaaaga
tatcttcatctctcgatatcaaatggtagcatccaagtggatgcctcctttatgcaaaca
ctctggaacgtacatcctacctgctcaggaagtagcattgaagaaggatacttactcggt
ggccatgtagttcgtcttttccacggtcatgatgaatgtttgacgataccatctacagat
cagaatgattctcagcacaggagggtgttctatgaagctggaggagctgggaccagagcc
aggtctctatggagagtggaaccccttcggataagctggagtggcagtaacatcaggtgg
ggccaggccttccgactccggcatcttaccacaggccactacttggccttgacagaagac
caaggccttcttctacaagaccggggaaaatccgacaccaaatccacagccttctccttc
cgagcatcaaaggaaatcaaggagaaattagattccagtcacaaaagagatatggaaggc
atgggagttccagaaatcaagtacggggattctgtctgctttgttcagcatgtagccagt
ggcctttgggtcacctacaaagcacaagatgccaaaacttcccgcctgggacctctgaaa
agaaaggtcatactccatcaggaaggccacatggatgacggattaacactgcagaggtgc
cagcaggaagagtcccaggctgctcgcatcatccggaacacaaccgccttattcagccag
tttgtcagtggaaacaatcgcacaactgcccctgtcgccttgccaacagaagaggttctg
cagaccctgcaagacttgatagcctacttccagccaccagaggacgagatgcaacatgaa
gacaaacagaataagctccgctctctaaagaacagacaaaatcttttcaaggaggagggg
atgctggccctcgtattgaattgcattgatcgattaaacatctacaatagtgtagcacac
tttgcagggatcgtaagggaagagagtggcatggcctggaaagaaattctgaacctgcta
tacaaattactagccgctctcatacgtggaaacagaaacaattgtgctcaattctccaat
aaccttgattggttaattagtaagttggacagactagaatcttcctcaggtatcttggag
gtcttgcactgcatcttgattgaaagcccagaagccttaaacctaatagcagagggccac
atcaagtctatcatctccctactggataagcatgggcggaatcacaaggttctcgatgtc
ctgtgctccctctgtctctgcaatggggttgcagtaagagccaaccagaatctgatctgt
gacaacctactaccccggaggaacctgcttctgcagacacgactaattaatgatgtcacc
agcatccggccaaacatcttcctgggagttgctgaaggttcaccacagtacaagaagtgg
tactttgagttaattatcgaccaggtggagcctttcctaacagcagagcctacacatctg
cgagtgggctgggcctcctcttcaggctatgccccgtaccctggtggtggagaaggatgg
ggaggcaatggtgtcggtgatgatctgtactcctatggctttgatgggcttcatctgtgg
tcaggacggatacccagagctgtggcttccatcaaccagcatctgctcaagtcagacgat
gtggtgagctgctgccttgaccttggagtacccagcatttctttccgaatcaatggacaa
cctgtgcaggggatgtttgagaatttcaacacagatggactcttcttccctgtgatgagt
ttttcagctggtgtcaaagtacgcttcctgatgggtggtcggcatggagaatttaagttc
ctgcctccctcaggctatgccccttgctatgaagccttacttcctaaggagaagatgaga
ttggagcctgtcaaagaatataagcgtgatgctgatggtgtgagagatctattgggtacc
acacagttcctctcccaagcctctttcatcccatgtcccatagataccagtcaggttgtt
ttgccacttcacctagagaagatccgagacagactggctgagaacatccacgagctttgg
gggatgaacaaaatagaactcggctggacttatggcaaagtgcgggatgacaacaaaagg
cagcatccctgccttgtggagttttcaaagctccctgaaactgagaagaattataacctg
cagatgtcaacggaaaccttgaaaaccttgctggccctggggtgccacattgctcatgtt
aacccagctgcggaagaggatctaaagaaagtcaagcttcccaaaaactatatgatgtcc
aatggctataagccagcccctttggatttatctgatgtgaagctgttaccacctcaagaa
attttagtggataagcttgcagaaaatgctcacaatgtttgggcaaaggacagaattaaa
caaggttggacctatggtattcaacaggatctgaagaataaaagaaatccccgcctggtg
ccatatgcattactagatgagcgcaccaagaaatcaaacagggacagcctacgtgaagct
gtacggacatttgttggttatgggtataacattgagccttcagaccaagaactagctgat
cctactgtcgagaaggtcagcatagacaagatccggtttttccgagtagaacggtcatat
gctgtaaagtctggaaagtggtactttgaatttgaagtggtaactggaggagacatgcgt
gttggctgggccaggccaggctgtcgtcctgacattgagctgggggctgatgatcaagcc
ttcgtgtttgaaggaagcaggggtcagcgttggcatcaaggcagtgggtattttggacga
acttggcagccaggagatgtggtcgggtgcatgattaacctggatgatgcctccatggtc
ttcacactgaatggggaactgctcatcaccaacaaaggttctgaacttgccttcgcagac
tatgagattgagaacggttttgtgcccatttgctctctggggctatcccagattggccgc
atgaatcttgggacagatgccagtaccttcaagttttataccatgtgtggactccaggag
ggctttgagccttttgcggtaaatatgaaccgagatgttgcagtgtggtttagcaagcgc
ctcccaacatttgtgaatgtgcctaaggatcatccccacatagaggttgtgagaattgat
ggcaccatggacagccctccatgcctcaaggtgacccacaagaccttcggcacacagaac
agcaatgccaacatgatctactgccgcctgagcatgcctgttgaatgtcattcctctttc
agtcacagtccctgtctagacagtgaagccttccaaaaaaggaaacagatgcaagaaata
ctatctcacacaacaacacaatgctactatgctatccgcatttttgctgggcaggaccca
tcatgtgtctgggttggatgggtgactccggactaccatttatacagtgaaaagtttgac
ctgaataaaaactgcactgtgactgtcaccctgggagatgaaagaggccgggtccatgaa
agtgtgaaacgcagcaactgctacatggtctggggtggggatattgtagccagttcccaa
agatcaagtcggagcaatgtagacctggagattggctgccttctagatctggcaatgggc
atgttgtccttctcagctaatgggaaggaacttggcacctgctaccaggtggagcctaac
accaaagtgttccctgcagtcttccttcagcctaccagcacgtccttgtttcagtttgaa
cttggaaaactgaagaatgcaatgcctctgtcagcagccatatttaagagtgaagagaag
aaccccaccccacagtgtccacctcggctggatgtccaaaccatccagcctgtactctgg
agtcgaatgcccagcagcttcctcaaagtggagacagagcgggtgagcgagcgccatggc
tgggtggtgcagtgcctagaacccctgcagatgatggcactccacatccctgaggagaac
aggtgtgtggacatcctcgagctctgtgagcaggaggacctgatgcagttccattaccac
acactgagactttacagcgctgtgtgcgctctgggaaatagccgagtggcttctgccctg
tgcagccacgtggacctctcacagctcttctacgccattgacaacaagtacttgcctggc
ctccttcggtctggcttctatgacctgctcattagcatccacctggccaatgctaaggag
aggaagctgatgatgaagaatgagtacatcattcctatcaccagcgccaccaggaatatc
cgcctatacccggatgagtccaagagacacggattgcctggggtgggcctgaggacatgc
ctcaagccaggcttcaggttctccaccccttgctttgtggtgacgagtgaggaccatcag
aagcagagccctgagattcccttgcagattctcaagacaaaagccctgagcatgctaacc
gaggccgtgcactgtagcggggcccacatccgagaccctgtcgggggttctgtggagttc
cagttcgtgcctgtgctgaaactcattggaaccttgttagtcatgggggttttcgacgac
gatgatgttcgccagattctcctcctgattgatccctctgtgtttggggagcacagtggg
gagacggaagaaggggtggaaaaagaagtgacccacgcagaggaaaaggcagtggaggct
ggagaaaaggcctgcaaggaggctccagtcaaaggcttgctgcagacccgattgcctgag
tctgtcaagctgcagatgtgcgaactcctcagctacctctgtgactgcgaactgcagcac
cgagtagaggctattgtggcatttggtgacatttacgtgtccaagctgcaggcaaatcag
aagttccgctacaatgagctcatgcaggccctgaacatgtctgcagccctaactgccaga
aagacaagagagttccgctcaccgccccaggagcagatcaacatgcttctcaactttcac
ctgggagagaactgcccctgcccagaggagatccgagaggagctgtatgacttccatgag
gaccttctggttcactgcggggttcccttggaggaagaggaagaggaggaggaggatact
tcctggacaggaaaactgtgtgctctggtgtataagatcaagggtccacccaagcctgag
aaggagcagccaacagaggaagagaaaccgtatcctacaacactgaaggaactagtttca
cagacaatgatccgctgggcccaggagaaccaaatccaggatgcggaactggtgaggatg
atgttcaacctccttcggagacagtatgacagcattggggagttgctccaggctctgcgg
aagacctacaccatcagccaggcctctgtgaatgacactatcaacctgctggctgccctg
ggccagattcggtccctgcttagtgtcaggatgggcagagaagaggagctcctcatgatc
aacgggctaggggacataatgaacaacaaggtgttttaccagcaccccaacctgatgaga
gtcctcggcatgcatgagactgtgatggaagtgatggtcaatgtgctgggtactgagaag
tcgcagattgccttcccaaagatggttgctagctgctgtcgcttcctttgctatttctgt
cgaattagccggcaaaatcagaaggccatgtttgagcatctaagttacctgctggagaac
agtagtgtgggtctagcgtccccatcgatgagggggtccaccccactggatgtggcagcc
tcctctgtgatggacaataatgaactagcactgggcttagaagaaccggatcttgagaag
gtcgtaacctacttggcaggctgtggccttcagagctgccccatgcttctggccagaggc
taccctgacgttggctggaaccccatcgaaggggagcgctacctgtccttcctgaggttt
gccgtcttcgtaaacagcgaaagtgtggaagaaaatgccagcgttgtggtcaaactgctc
atcagacgtcccgagtgcttcggcccagctctgaggggtgaaggaggcaacggactgctg
gcggctatgcagggtgctattaagatctcagagaaccctgccctcgacctcccttcccag
ggttacaagacagaagtcacacaggatgatggagaggaggaagagattgtgcatatgggc
aatgcaattatgtcattttattcagcgcttatagatctattgggccgctgtgctcccgaa
atgcatctcatccaaacagggaaaggggaagccatccggatccggtccatcctgcgctcc
ctggtccccacggaagacctggttgggatcatcagcatccccctcaaactgccctcccta
aacaaagatggttcagtcagcgagccagacatggcggccaacttctgccctgaccacaag
gcacccatggtgctgttcttggaccgtgtttatggcattaaagatcaaactttcctgctc
cacttgctggaagttgggtttttacctgacttacgggcttctgcatctctagatacagtg
tccctcagcaccacagaggctgcgctggcgctgaataggtatttatgttcggctgtgctc
ccactcctcactagatgcgcccctctcttttctgggacagaacactgtacttctctgatt
gattctacactgcagacaatatacaggctttccaaaggacgctccctcaccaaggcacag
agggacaccatagaagaatgtttgctagccatttgcaatcatttgagaccttccatgtta
cagcaactcctgcgtcgtctggtttttgacgtgccacagctcagcgagtactgcaagatg
ccccttaagcttctgacaaatcactacgagcagtgctggaagtattactgcctgccttcg
ggatgggggagctatgggctggctgtggaggaggagctgcacctcactgagaagctcttc
tgggggatctttgactccctctcccacaagaaatatgacctggaccttttccgaatggcc
ctgccttgtctcagtgctattgctggggccttgccaccagactatttagatacgagaatt
acagccacattggagaagcaggtctcagtggatgcagatggaaactttgaccccaaacct
atcaacaccatgaatttttccttgcctgaaaaattggaatacattgtcaccaagtatgct
gagcattctcatgataaatgggcttgtgacaagagtcacagtggatggaaatatgggatt
tctctggatgaaaatgtgaagacacacccactaatacggcccttcaagacattaacagag
aaggagaaggaaatttatcgctggcctgccagagagtccctgaaaaccatgctggctgtg
ggctggacagtggaaaggaccaaagaaggagaagccttggttcaacaaagagagaatgag
aagcttcgatgtgtgtcccagaccaatcagggcaatagttacagccccgcccctctggat
ctctcaaatgttgtgctgtccagggagcttcagggaatggtggaggtggtggctgagaac
tatcacaatatctgggccaagaagaagaagctggagctggaaagcaagggtggtggcagc
cacccgcttttggtaccatatgacaccttgactgccaaggaaaagttcagggatcgagag
aaggcccaggacctgttcaaattcctccaagtgaatggcattctagtttctagaggcatg
aaggacttggagctggatgcctcctccatggagaagagatttgcctacaagtttttgaag
aagatcctgaagtatgttgacgctgctcaagagtttattgctcacttggaagccattgtc
agcagtgggaagacagaaaagtctccccatgaccaggagatcaaattctttgccaaagtt
ctcctcccactggtcgaccagtacttcaccaaccaccgcctgtatttcctgtcgtctcct
ctgaagccgctcagcagcagtgggtatgcttcccataaagagaaagaaatggtggccagc
ctattctgcaagctggccgctcttgttagacacaggatttcactctttgggagcgattca
actacaatggtgagctgtcttcatatcttagctcagacacttgacacaaggacagtgatg
aagtcaggctcagagctggtgaaagccgggctgcgagcattctttgaaaatgctgctgaa
gacttagagaagacctccgaaaacctgaagctggggaagtttacccattcccgaacgcag
atcaaaggtgtttctcagaatattaactacaccacagtggctctgcttcccatcctgaca
tccatctttgagcacatcgctcagcatcagtttggggtggatctactcttgagcgacgtg
caggtttcatgctaccacattctgtgcagcctctactcccttgggactgggaaaaacatc
tatgttgaaaggcaacgtcctgctcttggagaatgtctggcttccctagcagctgctatc
cctgtggcctttctggagcccagccttaaccgccacaatcccctctcagtcttcaacacc
aaaacccccagggagcgctctattctggggatgccagacaaggtggaggacatgtgtcct
gacatccctcagctggaaggcctgatgaaggaaatcaatgacttggccgagtcaggtgcc
cggtacactgagatgccccatgtcattgaagtgatcttgcccatgctctgcaactacctg
tcctactggtgggagcggggacctgagaacctgccccccagcacaggaccctgctgcacc
aaggtcacatctgaacacctcagcctcatcctgggcaacatcctgaaaatcatcaacaac
aacctgggcattgatgaggcctcctggatgaagcgcatcgcagtgtatgcccagccaatt
atcagcaaagccaggcccgacctgcttcgaagccacttcatccccaccctggagaagcta
aagaagaaggcggtgaagactgtgcaggaggaggagcagctgaagaccgatggcaagggg
gacacccaggaggctgagctcctcatcctagatgagtttgctgtcctctgcagggacctc
tatgccttctaccccatgctgatccgctatgtggacaacaacagatctaactggctcaaa
agcccagatcctgattctgaccagctcttccgcatggtggccgaggtcttcattctgtgg
tgtaaatctcataacttcaagagggaagagcaaaattttgtgattcaaaatgaaattaat
aacttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaagtaaag
tctggaggacaggaccaggaacggaagaagacaaagaggcgaggagacttgtattccatc
cagacgtcccttatcgtggctgcgctcaagaaaatgctgcccattggtctgaacatgtgt
actccaggcgaccaggagctcatctcactcgcaaaatcacgatacagctgtagggacact
gatgaagaagtcaaggaacatcttcggaataacctgcacctgcaggagaagtctgatgac
ccagctgtgaaatggcaactgaacctctacaaggacgttctgaggaatgacgagccttct
aatccagaaaagacggtggagcgggtgcagagcatttcggcagctctcttccaccttgag
caggtggaacagcctttgaggtccaaaaaggctgtatggcacaaattgttgtcaaagcaa
cggaaacgggcagtggtggcctgtttcaggatggctcccctctacaatctgcccaggcac
cgctctattaacctcttcctccatggctatcagagattctggatagaaacagaggcgcat
ttctttgaagagaaactagtacaggatctggctaaatctcccagggttgaagatgaggaa
gaagaggagacagagaggcaacctgacccacttcaccagatcattctgcattttagtcgc
aacgcgctcacggagaggagcaaattggaagatgatccattgtacacttcctattccagc
atgatggccaagagctgtcagagtggtgaggatgaagaagaagaagaagacaaggaaaaa
acctttgaagagaaggagatggagaagcaaaaaacactgtatcaacaagcaaggctgcac
gagcgtggtgctgcagagatggtccttcagatgataagtgccagcaaaggtgagatgagc
cccatggtggttgagacactgaagctggggattgccattctgaacggaggcaatgctggt
gtgcaacagaaaatgctagattacttaaaggagaaaaaagatgctggattctttcaaagc
ctctctggtcttatgcagtcctgcagtgtccttgatttgaatgcatttgagagacagaat
aaagctgaaggcctggggatggttacagaagaagggacactcattgttcgtgagcgtggt
gaaaaggtactccagaatgatgaattcacacaagatctctttagattcctacagttgctt
tgtgaaggacataacagtgactttcagaacttcctgaggactcagatgggcaacaccact
actgtgaacatcatcattagcactgtggactaccttctgcgtctgcaggaatcaatcagc
gatttctattggtactattcaggaaaggacatcattgatgaatctggacagcataatttc
tctaaagctctggcagtcaccaagcaaatttttaattctcttacagagtacatccagggc
ccttgcatcgggaaccagcaaagcctggctcacagtaggctgtgggatgcagtagtcggg
ttcctccatgtatttgctaacatgcagatgaagctttctcaggattccagtcagatcgag
ctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtccctcctg
gaaggaaatgtggtaaatgggactatcggaaagcagatggttgacacgctggtagaatca
tccactaatgtagagatgatcttgaaattctttgacatgtttttgaaacttaaagactta
accagctcagacaccttcaaagaatatgacccagatggcaaagggatcatctctcgaaaa
gaatttcagaaggccatggaaggtctaaagcaatatacacagtcagagatcgactttctc
ctttcatgtacagaggctgatgagaacgacatgtttaattatgtggattttgtagagagg
ttccatgagccagccaaggacatagggttcaatgtggcagtgttattgacaaatctctct
gaacatatgcccaacgattcccgtctcaagagtctgttggacccagcagaaagtgtgcta
aattacttcgagccatacctgggtcgaattgagatcatgggtggggccaagaaaattgag
cgtgtttattttgagatcagtgaatccagtcgaactcagtgggaaaaacctcaagtgaag
gaatctaagcgacagttcatcttcgatgttgtcaatgaaggcggggagcaagagaagatg
gaattgtttgtgaacttctgtgaggatacaatctttgagatgcaattagcatctcagatc
tcagaatctgactcaactgacaggccggaagaggaagaggaagaggatgaagactctgct
tattctatagaaaccgagggggaggaggaagagaaatcttttgagtctgcctctgctttt
actatggcctgtgtctcagtaaagagaaatgtcaccaagtttctgaagagggcaaccttg
aagaacctcaggaaacaatacaggaatgtaaaaaagatgagtgcaaaggaactggtcaag
gtgttcttctccttcttctggatgctgtttgtgggcctctttcagttgctcttcacaatc
tttggaggaatctttcagatcctctggaacacagtgtttggagggggccttgtcgaaggg
gcaaagaacatcagagtgactaagatcctaggtgacatgcccgaccccactcagtttggg
atccatgatgatgtaatagaaactgacagggcagaagtgactgagccaggtgtcaccact
gagctggtccactttgtaaagggtgaggcaggagatacagacatcatgtcagacctcttt
ggaatccactccaagaaagaaggtggcttaaagcaagggcctgaagtgggattaggtgac
ctctctgaaattatcggcaaggacgaacccccaacattagagagtactgtgcggaagaaa
agaaaagcacaggcagcagagatgaaagcagtgcatgaagctgaaggaaaagctgaatct
gagaaggccgacatggaagacagagaaaaggaagacaaaatcaaggaggaggggcaaaca
gactacctgtgggcagacgtgacagtaaagaagacgagacggcgcggtcagaaggctgag
aagccagaagcctttatggccaacttcttcaaagggctggagatttatcagaccaagtta
ttgcactacctggccaggaatttctacaacctgaggttccttgctctgtttgtagccttc
gctatcaacttcatcctgcttttttataaggtcactgaagaacctttagaggaagagaca
gaggatgttgcaaacctgtggaactcattcaatgatgatgacgaggaagaagcgatggtg
ttctttgttcttcaggagagcactggttatatggcaccaacactgcgtgctttggccatt
gtccacaccatcatctctctggtctgtgtggtgggctattactgcctgaaggtacctttg
gtggtattcaaaagggagaaagaaattgccaggaagctggagtttgatggcctctatatc
actgaacagccatctgaggatgacatcaaggggcagtgggaccgcttggtaatcaacacg
ccatcttttcctaataactactgggacaagtttgtgaagagaaaggtgatcaacaagtat
ggagatctctatggagcagagcgcatcgctgaactcctgggtttggacaaaaatgccctt
gactttagcccagtagaagaggccaaagcagaggcagcatctctggtgtcatggctaagt
tccatcgacatgaagtaccatatttggaagctaggggtggttttcactgacaactccttt
ctctaccttgcctggtacacaaccatgtctgtcctgggccactacaacaacttcttcttt
gctgctcatctgttggatattgcaatgggctttaagaccttgaggacgatcctgtcatct
gtaactcacaatggcaaacagctggttctgaccgttggcctcctggctgtggttgtttac
ctctatactgtggtggctttcaacttcttccgaaagttctacaacaaaagtgaagatgac
gatgagccggatatgaagtgtgacgacatgatgacgtgctacctcttccacatgtacgtg
ggcgtaagagcaggtggaggcattggtgatgaaattgaagaccccgctggtgacccttat
gaaatgtatcgcatcgtctttgatattaccttcttcttcttcgtcattgtcatcttgctg
gccatcattcaaggtcttattattgatgcttttggagagctgcgggaccagcaggagcaa
gtacgggaagacatggagaccaagtgcttcatctgcggcattggcaatgactactttgac
acgacccctcatggttttgaaacacatacactgcaagagcacaacttagccaattatcta
ttctttctgatgtatttgattaacaaggatgaaacagaacatacgggccaggaatcctat
gtgtggaagatgtaccaggaaaggtgttgggacttcttcccagctggagactgctttcgg
aagcaatatgaagatcagctcgggtaa

DBGET integrated database retrieval system