KEGG   Mus musculus (mouse): 20194
Entry
20194             CDS       T01002                                 

Gene name
S100a10, 42C, AA409961, AL024248, CAL, CAL12, CLP, CLP11, Ca, Cal1l, p1, p10, p11
Definition
(RefSeq) S100 calcium binding protein A10 (calpactin)
  KO
K17274  protein S100-A10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    20194 (S100a10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20194 (S100a10)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20194 (S100a10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   20194 (S100a10)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   20194 (S100a10)
SSDB
Motif
Pfam: S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8
Other DBs
NCBI-GeneID: 20194
NCBI-ProteinID: NP_033138
MGI: 1339468
Ensembl: ENSMUSG00000041959
Vega: OTTMUSG00000022124
UniProt: P08207 Q3TC45
Position
3 F2.1; 3 40.51 cM
AA seq 97 aa
MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK
NT seq 294 nt   +upstreamnt  +downstreamnt
atgccatcccaaatggagcacgccatggaaaccatgatgcttacgtttcacaggtttgca
ggcgacaaagaccacttgacaaaggaggacctgagagtgctcatggaacgggagttccct
gggtttttggaaaatcaaaaggaccctctggctgtggacaaaataatgaaggacctggac
cagtgccgagatggcaaagtgggcttccagagctttctatcactagtggcagggctcacc
attgcatgcaatgactattttgtagtaaacatgaagcagaaggggaagaagtag

DBGET integrated database retrieval system