KEGG   Mus musculus (mouse): 20195
Entry
20195             CDS       T01002                                 

Gene name
S100a11, EMAPI, Ema, Emap1, S100, S100a, S100a14, S100c, c, cal, calg
Definition
(RefSeq) S100 calcium binding protein A11
  KO
K23765  protein S100-A11/13
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20195 (S100a11)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   20195 (S100a11)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 EF-hand_4
Other DBs
NCBI-GeneID: 20195
NCBI-ProteinID: NP_058020
MGI: 1338798
Ensembl: ENSMUSG00000027907
Vega: OTTMUSG00000022126
UniProt: P50543
Position
3; 3 F2.1
AA seq 98 aa
MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMK
KLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI
NT seq 297 nt   +upstreamnt  +downstreamnt
atgcctacagagactgagagatgcattgagtccctgattgctgttttccaaaagtacagc
gggaaggatggaaacaacactcaactctccaaaactgaattcctttccttcatgaacaca
gagctggctgccttcacaaagaaccagaaggatcctggtgtccttgaccgcatgatgaag
aagctggacctcaactgtgacgggcagctagatttccaagagtttctcaacctcattggt
ggcttagctatagcgtgccatgattctttcatccaaacttcccagaagcgaatctaa

DBGET integrated database retrieval system