KEGG   Mus musculus (mouse): 20196
Entry
20196             CDS       T01002                                 

Gene name
S100a13
Definition
(RefSeq) S100 calcium binding protein A13
  KO
K23765  protein S100-A11/13
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20196 (S100a13)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   20196 (S100a13)
Motif
Pfam: S_100 EF-hand_7
Other DBs
NCBI-GeneID: 20196
NCBI-ProteinID: NP_033139
MGI: 109581
Ensembl: ENSMUSG00000042312
Vega: OTTMUSG00000022110
UniProt: P97352 A0A0A0MQ90 Q545H7
Structure
PDB: 
2CXJ

Position
3 F1; 3 39.24 cM
AA seq 98 aa
MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKM
KTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK
NT seq 297 nt   +upstreamnt  +downstreamnt
atggcagcagagactctgactgaactggaggcggccattgagactgtggtctctactttc
ttcacctttgcagggcgggaaggacgcaaaggcagcctgaacatcaatgaatttaaggaa
ctggccactcagcaactgcctcatttgctcaaggacgtgggctctctagatgaaaagatg
aagaccttggatgtgaatcaggactcagagctgaggttcagtgaatactggagactgatt
ggagagctggcaaaggaagtcaggaaggagaaggccctggggatccggaagaagtaa

DBGET integrated database retrieval system