KEGG   Mus musculus (house mouse): 20197
Entry
20197             CDS       T01002                                 
Symbol
S100a3, S100E
Name
(RefSeq) S100 calcium binding protein A3
  KO
K23760  protein S100-A3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20197 (S100a3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   20197 (S100a3)
SSDB
Motif
Pfam: S_100 EF-hand_1
Other DBs
NCBI-GeneID: 20197
NCBI-ProteinID: NP_035440
MGI: 1338849
Ensembl: ENSMUSG00000001021
UniProt: P62818 Q496W1
Position
3:90467649..90510922
AA seq 101 aa
MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMS
VLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacccggcccctggagcaggcagtagctgccatcgtgtgcaccttccaggagtatgca
gggcgctgtggggataaatacaagatctgccagtcggagctcaaggagttgttgcagaag
gagctgcccacctggacgccgagtgagttccgggagtgtgactacaataaattcatgagt
gttctggataccaacaaagactgcgaagtggactttggggagtacgtgcgctcacttgcc
agcctctgtctctactgccacgagtacttcaaagagtgcccccctgagcctccttgcccc
cagtag

DBGET integrated database retrieval system