KEGG   Mus musculus (house mouse): 20198
Entry
20198             CDS       T01002                                 
Symbol
S100a4, 18A2, 42a, Capl, FSp1, Mts1, PeL98, metastasin, pk9a
Name
(RefSeq) S100 calcium binding protein A4
  KO
K23761  protein S100-A4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20198 (S100a4)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   20198 (S100a4)
SSDB
Motif
Pfam: S_100 EF-hand_7 EF-hand_1 EF-hand_4 EF-hand_6 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 20198
NCBI-ProteinID: NP_035441
MGI: 1330282
Ensembl: ENSMUSG00000001020
UniProt: P07091 Q545V2
Position
3:90511077..90513352
AA seq 101 aa
MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMS
NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
NT seq 306 nt   +upstreamnt  +downstreamnt
atggcaagacccttggaggaggccctggatgtaattgtgtccaccttccacaaatactca
ggcaaagagggtgacaagttcaagctgaacaagacagagctcaaggagctactgaccagg
gagctgcctagcttcctggggaaaaggacagatgaagctgcattccagaaggtgatgagc
aacttggacagcaacagggacaatgaagttgacttccaggagtactgtgtcttcctgtcc
tgcattgccatgatgtgcaatgaattctttgagggctgcccagataaggagccccggaag
aagtga

DBGET integrated database retrieval system