KEGG   Mus musculus (mouse): 20199
Entry
20199             CDS       T01002                                 

Symbol
S100a5, S100D, S100D9
Name
(RefSeq) S100 calcium binding protein A5
  KO
K23762  protein S100-A5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20199 (S100a5)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   20199 (S100a5)
SSDB
Motif
Pfam: S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 20199
NCBI-ProteinID: NP_035442
MGI: 1338915
Ensembl: ENSMUSG00000001023
Vega: OTTMUSG00000022120
UniProt: P63084 Q149U2
Position
3 F1; 3 39.27 cM
AA seq 93 aa
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLAEKMKESSIDNLMKSL
DKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK
NT seq 282 nt   +upstreamnt  +downstreamnt
atggagactcctcttgagaaggcactgaccaccatggtcaccactttccataaatattca
gggagagagggtagcaagctgaccctgagtaggaaagaactgaaggagttgatcaagaca
gagctgagtcttgcagagaagatgaaggagagcagcattgataacttgatgaagagcctg
gacaaaaacagcgaccaggagattgacttcaaggagtactctgtgttcctgaccacgctg
tgcatggcctacaatgacttcttcctagaggacaacaaatga

DBGET integrated database retrieval system