KEGG   Mus musculus (mouse): 20200
Entry
20200             CDS       T01002                                 

Gene name
S100a6, 2A, 2A9, 5B10, CALC, CALCYCLIN, Cac, Cacy, PRA
Definition
(RefSeq) S100 calcium binding protein A6 (calcyclin)
  KO
K23764  protein S100-A6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20200 (S100a6)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   20200 (S100a6)
SSDB
Motif
Pfam: S_100 EF-hand_7 EF-hand_1
Other DBs
NCBI-GeneID: 20200
NCBI-ProteinID: NP_035443
MGI: 1339467
Ensembl: ENSMUSG00000001025
Vega: OTTMUSG00000052755
UniProt: P14069 Q545I9
Structure
PDB: 
4P2Y

Position
3 F1; 3 39.35 cM
AA seq 89 aa
MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDL
DRNKDQEVNFQEYVAFLGALALIYNEALK
NT seq 270 nt   +upstreamnt  +downstreamnt
atggcatgccctctggatcaggccattggccttctcgtggccatcttccacaagtactct
ggcaaggaaggtgacaagcacaccctgagcaagaaggagctgaaggagttgatccagaag
gagctcaccattggctccaagctgcaggatgctgaaattgcaaggctgatggatgatctg
gaccgtaacaaggatcaggaagtaaacttccaggagtatgtcgccttcctgggggccttg
gctttgatctacaatgaagctctgaaataa

DBGET integrated database retrieval system