KEGG   Mus musculus (mouse): 20201
Entry
20201             CDS       T01002                                 

Gene name
S100a8, 60B8Ag, AI323541, B8Ag, CFAg, CP-10, Caga, MRP8, p8
Definition
(RefSeq) S100 calcium binding protein A8 (calgranulin A)
  KO
K21127  protein S100-A8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    20201 (S100a8)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_8 EF-hand_7 EF-hand_5 EF-hand_6
Other DBs
NCBI-GeneID: 20201
NCBI-ProteinID: NP_038678
MGI: 88244
Ensembl: ENSMUSG00000056054
Vega: OTTMUSG00000052758
UniProt: P27005 Q53X15
Position
3 F1; 3 39.9 cM
AA seq 89 aa
MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDI
NSDNAINFEEFLAMVIKVGVASHKDSHKE
NT seq 270 nt   +upstreamnt  +downstreamnt
atgccgtctgaactggagaaggccttgagcaacctcattgatgtctaccacaattattcc
aatatacaaggaaatcaccatgccctctacaagaatgacttcaagaaaatggtcactact
gagtgtcctcagtttgtgcagaatataaatatcgaaaacttgttcagagaattggacatc
aatagtgacaatgcaattaacttcgaggagttccttgcgatggtgataaaagtgggtgtg
gcatctcacaaagacagccacaaggagtag

DBGET integrated database retrieval system