KEGG   Mus musculus (house mouse): 20202
Entry
20202             CDS       T01002                                 
Symbol
S100a9, 60B8Ag, AW546964, BEE22, Cagb, GAGB, L1Ag, MRP14, p14
Name
(RefSeq) S100 calcium binding protein A9 (calgranulin B)
  KO
K21128  protein S100-A9
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    20202 (S100a9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20202 (S100a9)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   20202 (S100a9)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_5 EF-hand_4 EF-hand_7 EF-hand_8 EF-hand_6 Pox_D5
Other DBs
NCBI-GeneID: 20202
NCBI-ProteinID: NP_001268781
MGI: 1338947
Ensembl: ENSMUSG00000056071
UniProt: P31725 Q3UP42
Structure
Position
3:complement(90599937..90603028)
AA seq 113 aa
MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALI
NDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
NT seq 342 nt   +upstreamnt  +downstreamnt
atggccaacaaagcaccttctcagatggagcgcagcataaccaccatcatcgacaccttc
catcaatactctaggaaggaaggacaccctgacaccctgagcaagaaggaattcagacaa
atggtggaagcacagttggcaacctttatgaagaaagagaagagaaatgaagccctcata
aatgacatcatggaggacctggacacaaaccaggacaatcagctgagctttgaggagtgt
atgatgctgatggcaaagttgatctttgcctgtcatgagaagctgcatgagaacaaccca
cgtgggcatggccacagtcatggcaaaggctgtgggaagtaa

DBGET integrated database retrieval system