KEGG   Mus musculus (mouse): 20203
Entry
20203             CDS       T01002                                 

Gene name
S100b, AI850290, Bpb
Definition
(RefSeq) S100 protein, beta polypeptide, neural
  KO
K23770  protein S100-B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20203 (S100b)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   20203 (S100b)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_4 EF-hand_5 EF-hand_8 DUF4611
Other DBs
NCBI-GeneID: 20203
NCBI-ProteinID: NP_033141
MGI: 98217
Ensembl: ENSMUSG00000033208
Vega: OTTMUSG00000020277
UniProt: P50114 Q3UY00
Position
10 C1; 10 38.76 cM
AA seq 92 aa
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDEDGDGECDFQEFMAFVAMVTTACHEFFEHE
NT seq 279 nt   +upstreamnt  +downstreamnt
atgtccgagctggagaaggccatggttgccctcattgatgtcttccaccagtactccggg
cgagagggtgacaagcacaagctgaagaagtcagaactgaaggagcttatcaacaacgag
ctctctcacttcctggaggaaatcaaggagcaggaagtggtggacaaagtgatggagacg
ctggacgaagatggggatggggagtgtgacttccaggagttcatggccttcgtcgccatg
gtgaccacggcctgccatgagttctttgaacatgagtga

DBGET integrated database retrieval system