KEGG   Mus musculus (mouse): 20204
Entry
20204             CDS       T01002                                 

Gene name
Prrx2, Pr, Prx2, S, S8
Definition
(RefSeq) paired related homeobox 2
  KO
K09329  paired mesoderm homeobox protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20204 (Prrx2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    20204 (Prrx2)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 20204
NCBI-ProteinID: NP_033142
MGI: 98218
Ensembl: ENSMUSG00000039476
Vega: OTTMUSG00000011872
UniProt: Q06348 A2APZ7
Position
2 B; 2 21.74 cM
AA seq 247 aa
MDSAAAAFALDPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVSGPAE
AREGAAREPSGGSSGSEAAPQDGDCPSPGRGTKRKKKQRRNRTTFNSSQLQALERVFERT
HYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLATRSASLLKSYGQEAAIEQ
PVAPRPTTMSPDYLSWPASSPYSSVPPYSPGGSSPATPGVNMANSIASLRLKAKEFSLHH
SQVPTVN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggacagcgcggccgccgccttcgccctagacccgccagcgcccggcccggggcccccg
cccgcacccggcgattgcgcccaggcgcgcaagaacttctcggtgagccacctcctggac
ctggaggaggtggcggctgctgggcgcagggctgcggggcccgtttcggggcccgccgag
gcgcgggagggagcggcgcgcgaaccgtccgggggcagcagcggcagcgaggcggcgccg
caggacggtgactgtcccagccccggccgtggcaccaaacgaaagaagaagcagcgccgg
aatcgaaccacattcaacagcagccagctgcaggcgctggagcgtgtatttgagcgcaca
cactaccctgacgcctttgtgcgtgaagagctagctcgccgtgtcaacctcagtgaggca
cgtgtccaagtctggttccagaaccgccgtgccaagtttcgccggaatgaacgtgccatg
ctggctacccgctctgcctcgttgctcaagtcttatggccaggaggcggccattgaacag
cctgtggccccccgacctaccacgatgagcccagattatctatcctggccagcatcctcc
ccctacagctccgtgcctccctatagccccggaggttcaagtcctgcaactcctggagtc
aacatggccaacagcatcgccagccttcgcctcaaggccaaagagttcagcctacaccac
agccaggtgcccacagtgaactga

DBGET integrated database retrieval system