KEGG   Mus musculus (mouse): 20218
Entry
20218             CDS       T01002                                 

Gene name
Khdrbs1, Sam, Sam68, p6, p62, p68
Definition
(RefSeq) KH domain containing, RNA binding, signal transduction associated 1
  KO
K13198  KH domain-containing, RNA-binding, signal transduction-associated protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    20218 (Khdrbs1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    20218 (Khdrbs1)
SSDB
Motif
Pfam: Qua1 Sam68-YY KH_1 KH_5
Other DBs
NCBI-GeneID: 20218
NCBI-ProteinID: NP_035447
MGI: 893579
Ensembl: ENSMUSG00000028790
Vega: OTTMUSG00000009514
UniProt: Q60749
Position
4; 4 D2.2
AA seq 443 aa
MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGGPRGGARASPA
TQPPPLLPPSTPGPDATVVGSAPTPLLPPSATAAVKMEPENKYLPELMAEKDSLDPSFTH
AMQLLSVEIEKIQKGESKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQ
GNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEA
YALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVSVRGRGAAPPPPPV
PRGRGVGPPRGALVRGTPVRGSITRGATVTRGVPPPPTVRGAPTPRARTAGIQRIPLPPT
PAPETYEDYGYDDTYAEQSYEGYEGYYSQSQGESEYYDYGHGELQDSYEAYGQDDWNGTR
PSLKAPPARPVKGAYREHPYGRY
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgcagcgccgggacgatcctgcctcgcgcctcacccggtcctcgggccgcagctgctcc
aaggacccgtcaggtgcccacccctcggtgcgtctgaccccgtctcggccgtcgccgctt
cctcaccggccccggggagggggaggtgggcccagaggaggcgctcgggcctcgcccgcc
acccagccgccgccgctgctgcctccctccacccctggtcccgacgcgacggtggtgggt
tccgcgccgaccccgctgctgcccccgtcagccacagccgcggtcaagatggagccggag
aataagtacctgcctgaactcatggccgagaaggactcgctcgacccgtccttcactcac
gccatgcagctgctgtccgtagaaattgagaagattcagaagggagagtcaaaaaaagat
gacgaggagaattatttggatttattttctcataagaacatgaagctgaaagaacgcgtg
ctgatacctgtcaagcagtatccaaagttcaattttgtggggaagattcttggaccacaa
ggaaatacaatcaaaagactccaggaagagactggtgcaaagatctctgtcttggggaag
ggttcaatgagagacaaagccaaggaggaagagttgcgcaagggtggagaccccaaatat
gcccatttaaatatggatctgcatgtcttcattgaagtctttggacccccgtgtgaagct
tatgctcttatggcccatgctatggaagaagtcaagaagttcctagtaccagatatgatg
gatgatatctgtcaggagcagtttctagaattgtcctacttgaacggagtacctgaaccc
tctcgtggtcgtggggtatctgtgagaggacgaggagctgcccctcctcctccacctgtt
cccagaggacgtggtgttggaccacctagaggagctttggttcgtggaaccccagtgaga
ggctccatcaccagaggtgccactgtgactcgaggagtgccacccccacctactgtgagg
ggtgctccaacaccaagagctcggacagctgggattcagagaatacctttgcctcccaca
cctgcaccagaaacatacgaagattatggatatgatgatacatacgcagaacagagttac
gaaggctatgaaggctattacagccagagtcaaggggagtcagagtattatgactatgga
catggggagctccaagattcttacgaagcctacggacaagatgactggaatgggaccagg
ccatcactgaaggctcctccagctaggccagtgaagggagcatacagagagcatccatat
ggacgttattaa

DBGET integrated database retrieval system