KEGG   Mus musculus (mouse): 20222Help
Entry
20222             CDS       T01002                                 

Gene name
Sf3a2, 66kDa, AW047242, PRP11, SFA66, Sap62
Definition
(RefSeq) splicing factor 3a, subunit 2
  KO
K12826  splicing factor 3A subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    20222 (Sf3a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    20222 (Sf3a2)
Spliceosome [BR:mmu03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    20222 (Sf3a2)
 Complex B
    20222 (Sf3a2)
 Complex C
   U2 SnRNP specific factors
    20222 (Sf3a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SF3A2 zf-met CactinC_cactus PRP4
Motif
Other DBs
NCBI-GeneID: 20222
NCBI-ProteinID: NP_038679
MGI: 104912
Ensembl: ENSMUSG00000020211
Vega: OTTMUSG00000032875
UniProt: G3UVU2 Q7TN25
Position
10 C1; 10 39.72 cM
AA seq 485 aa AA seqDB search
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL
TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVT
KQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIA
FKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPDALPPPPPGGLPLPPMPPTGPAPSGPPGPPQMPPPAPGVHPPAPVVHPPTSG
VHPPAPGVHPPAPVVHPPTSGVHPPAPGVHPPTPGVHPPAPGVHPPAPGVHPPAPGVHPP
TPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPPAPAVHPQAPGVHPPAPG
IHPQAPGVHPQPPPGVHPAAPGVHPQPPGVHPSNPGVHPAPMPPMLRPPLPSDGPGNMPP
PPPGN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggactttcagcacagacctggaggcaagactgggagtgggggcgtagcctcctcctct
gagagcaaccgggatcggagagagcgtctgcgccaattggccctggaaaccattgacatc
aacaaggacccgtattttatgaagaaccacttgggatcctatgagtgcaaactctgcctg
actctgcataacaatgaggggagctacctggcccatacccaagggaagaaacatcagact
aacttggcccggcgagctgccaaggaggccaaagaagcccccgcccagcctgcaccggag
aaggtcaaggtggaggtgaagaagtttgtgaagattggccgccctgggtacaaagtgacc
aagcagagggacacagagatgggccagcagagcctgctgttccagattgactaccctgag
atcgcagagggtatcatgccacgccaccgtttcatgtctgcttatgagcagaggatcgag
cctccagaccgccgctggcagtacctgctcatggctgctgagccctatgagaccattgct
ttcaaggtgccaagccgggagattgacaaggctgagggcaagttttggacccactggaac
agagaaaccaagcagttttttcttcagttccactttaagatggagaagcccccagcacct
cccagcctcccagcaggacccccaggcgtcaagcggcccccgcccccactcatgaatgga
ctgcctcctcgcccaccactccctgatgccttgcccccacctccacctggtggcctgcct
ctccctcctatgccccccactgggcctgctccctctgggccccctggacctccccagatg
cccccaccagctcctggggtgcaccccccggccccagtagtacacccaccaacatctgga
gtccatcccccagctcctggggtacaccccccagcaccagtggtccatccaccaacatct
ggggtccatcccccagcccctggagtgcacccacccacccctggagtgcacccaccagcc
ccaggagtgcacccaccagctccaggtgtccacccaccagctccaggggtacacccccca
actccaggggtgcacccaccagctccaggggtgcacccaccagctccaggggtgcaccca
ccagctccaggggtacaccctcctccatcagctggagttcatcctcaggctccaggggta
cacccacctgctcctgcagtacaccctcaagcccctggggtacaccccccagcccctggg
atccaccctcaggcaccaggggttcaccctcagccgcctcctggagtccaccctgctgcc
ccgggggtccaccctcagcctccaggggttcacccctcaaatcctggggtgcaccctgct
cctatgccccccatgctgaggcccccactcccctcagatggccctgggaacatgcctccc
cctcccccaggcaactga

DBGET integrated database retrieval system