KEGG   Mus musculus (mouse): 20224
Entry
20224             CDS       T01002                                 

Gene name
Sar1a, 1600019H17Rik, S, Sara, Sara1
Definition
(RefSeq) secretion associated Ras related GTPase 1A
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    20224 (Sar1a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    20224 (Sar1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20224 (Sar1a)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    20224 (Sar1a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     20224 (Sar1a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    20224 (Sar1a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Sar
    20224 (Sar1a)
SSDB
Motif
Pfam: Arf SRPRB G-alpha Roc Ras MMR_HSR1 GTP_EFTU Metalloenzyme
Other DBs
NCBI-GeneID: 20224
NCBI-ProteinID: NP_001345416
MGI: 98230
Ensembl: ENSMUSG00000020088
Position
10; 10 B4
AA seq 198 aa
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLMESKVELNALMT
DETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSV
LKRQGYGEGFRWLSQYID
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtctttcatctttgagtggatctacaatggcttcagcagtgtgctccagttcctagga
ctctacaagaaatctggaaaacttgtattcttaggattggacaatgcgggcaaaaccact
cttcttcacatgctgaaagatgacagactaggccagcacgtaccaacactccatcccact
tcagaagaactgacaattgctggaatgactttcaccacttttgatctcggtgggcatgag
caagcacgtcgcgtttggaaaaattatctcccagcgattaatggcatagtttttctggtg
gactgtgcggatcattctcgtctcatggaatccaaagttgagcttaatgctttaatgact
gatgaaacaatatccaacgtgccaattcttatcttgggaaacaaaattgacaggacagat
gcaatcagtgaagaaaaactccgtgaaatatttgggctgtacgggcagaccacaggaaag
gggaatgtgactctgaaggagctgaacgcccgccccatggaagtattcatgtgcagtgtg
ctcaagaggcaaggctacggcgagggtttccgctggctttcccagtatattgactga

KEGG   Mus musculus (mouse): 66397
Entry
66397             CDS       T01002                                 

Gene name
Sar1b, 2310075M17Rik, 2900019I22Rik, CMRD, S, Sara1b, Sara2, Sarb
Definition
(RefSeq) secretion associated Ras related GTPase 1B
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66397 (Sar1b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    66397 (Sar1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66397 (Sar1b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    66397 (Sar1b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     66397 (Sar1b)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    66397 (Sar1b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Sar
    66397 (Sar1b)
SSDB
Motif
Pfam: Arf G-alpha SRPRB Roc MMR_HSR1 Ras GTP_EFTU Metalloenzyme
Other DBs
NCBI-GeneID: 66397
NCBI-ProteinID: NP_079811
MGI: 1913647
Ensembl: ENSMUSG00000020386
Vega: OTTMUSG00000005609
UniProt: Q9CQC9 Q0VGU0
Position
11; 11 B1.3
AA seq 198 aa
MSFIFDWIYSGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMT
DETIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCSV
LKRQGYGEGFRWMAQYID
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtccttcatatttgactggatttacagtggtttcagcagtgtgctgcagtttctagga
ttgtataaaaagtctggtaaactggtattccttggattggataatgccgggaaaacaact
ttgctacacatgctgaaagatgacaggctcgggcagcacgtcccaacgctacatcccact
tcagaagagcttactattgctggcatgacgtttacaacttttgatctgggtgggcacgtg
caagcccgaagagtatggaaaaactaccttcctgctatcaatggcattgtatttcttgtg
gattgtgcagaccatgaaaggctgttagaatcaaaagaagaacttgattcactaatgaca
gatgaaaccattgccaacgtgcctattctaattcttggaaataagatcgacagacctgaa
gccatcagtgaagagaggttacgagagatgtttggtttatatggtcagacaacaggaaag
ggtagtgtgtcactgaaggagctgaacgcccggcctctggaagtgttcatgtgcagtgtg
ctaaaaaggcagggctatggagaaggcttccgctggatggcgcagtacatcgattag

DBGET integrated database retrieval system