KEGG   Mus musculus (house mouse): 20226
Entry
20226             CDS       T01002                                 
Symbol
Sars, Sars1, Strs, serRS
Name
(RefSeq) seryl-aminoacyl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    20226 (Sars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    20226 (Sars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    20226 (Sars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     20226 (Sars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   20226 (Sars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    20226 (Sars)
 Prokaryotic type
    20226 (Sars)
SSDB
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N NOD
Other DBs
NCBI-GeneID: 20226
NCBI-ProteinID: NP_001191908
MGI: 102809
Ensembl: ENSMUSG00000068739
UniProt: P26638
Position
3:complement(108332180..108352575)
AA seq 512 aa
MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEAVGDDESVPENVLNFDDLTADALAALKVSQIKKVRLLIDEAIQKCDGE
RVKLEAERFENLREIGNLLHPSVPISNDEDADNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAVVAGSRGYFLKGPLVFLEQALIQYALRTLGSRGYTPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFDEMIATAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV
EFVHMLNATMCATTRTICAILENYQAEKGIAVPEKLREFMPPGLQELIPFVKPAPIDQEP
SKKQKKQHEGSKKKAKEVPLENQLQSMEVTEA
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggtgctggacctggatttgtttcgggtggataaaggaggggacccagccctcattcga
gagacgcaggagaagcgcttcaaggacccggggctggtggaccagctggtgaaagcagac
agtgagtggcgacgatgcagatttcgggcagacaacttgaacaagctgaagaatttatgc
agcaaaactattggggagaaaatgaagaaaaaggaagcagtgggagacgacgagtccgtc
ccagagaacgtgctgaatttcgatgacctcactgcagacgcgctagctgccctgaaagtc
tcacagattaaaaaagtccgactcctcattgatgaagccatccagaagtgtgatggggag
cgggtaaagctggaagcagagcgatttgagaacctccgcgagattgggaaccttctgcac
ccctctgtgcccattagtaatgatgaggacgcagacaacaaagtagaacgtatttgggga
gattgtacagtcaggaagaagtattcccatgtggacctggtggtgatggtagatggcttt
gaaggcgaaaagggagccgtggtggctggtagtcgggggtacttcctgaaggggcccctg
gtgttcctggagcaggcgcttatccaatatgcactgcgtaccttggggagtcggggctac
actccaatctacacccccttcttcatgaggaaagaggtcatgcaggaagtggcccagctc
agccagtttgatgaagaactttataaggtgattggcaaaggcagcgaaaagtcagatgac
aactcctatgacgagaaatacttgattgccacctcagagcagcccatcgcggctctgcac
cgggacgagtggctgcggccagaggatctgcccatcaagtacgctggcctctccacctgc
tttcgtcaggaagtgggctcgcatggccgtgacacccgtggtatcttccgagtccatcag
tttgagaagattgagcagtttgtgtactcatcgccccatgacaataagtcgtgggagatg
tttgatgagatgatcgccaccgcagaagaattctaccagtctttggggatcccttaccac
attgtgaatattgtctcaggctccttgaatcacgctgccagtaagaagctcgacctggag
gcctggttcccaggctcgggtgccttccgtgagttggtgtcctgttctaattgcacggat
taccaagctcgccgcctgagaatccgatatgggcagaccaagaagatgatggacaaggtg
gagtttgtccatatgcttaatgctacaatgtgtgctaccacccggaccatctgcgccatc
ctggagaactaccaggcagagaagggcatcgctgtgccagagaagttgagggagttcatg
ccgccagggctccaagagctgatcccgtttgtgaagcctgcacccattgaccaggagcca
tctaagaagcagaagaagcaacatgaaggcagcaaaaagaaagcgaaagaggtccccctg
gagaaccagctgcagagcatggaggtcactgaggcctga

DBGET integrated database retrieval system