KEGG   Mus musculus (mouse): 20227
Entry
20227             CDS       T01002                                 

Gene name
Sart1, U5-110K
Definition
(RefSeq) squamous cell carcinoma antigen recognized by T cells 1
  KO
K11984  U4/U6.U5 tri-snRNP-associated protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    20227 (Sart1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    20227 (Sart1)
   04121 Ubiquitin system [BR:mmu04121]
    20227 (Sart1)
Spliceosome [BR:mmu03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP specific factors
    20227 (Sart1)
 Complex C
   U4/U6.U5 tri-SnRNP specific factors
    20227 (Sart1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    20227 (Sart1)
SSDB
Motif
Pfam: SART-1 T3SS_needle_E
Other DBs
NCBI-GeneID: 20227
NCBI-ProteinID: NP_058578
MGI: 1309453
Ensembl: ENSMUSG00000039148
UniProt: Q9Z315
Position
19; 19 A
AA seq 806 aa
MGSSKKHRGEKEAAGTTAAAGTGGTTEQPPRHREHKKHKHRSSGGGSSGGERRKRSRERG
SERGSGRRGAEAEARSGAHGRERSQAEPSERRVKREKRDDGYEAAASSKASSGDASSLSI
EETNKLRAKLGLKPLEVNAVKKEAGTKEEPVAADVINPMALRQREELREKLAAAKEKRLL
NQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEE
FEQRRQDLYSARDLQGLTVEHAIDSFREGETVVLTLKDKGVLQDGEDVLVNVNMVDKERA
DKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILAKYDEELEGERPHSFRLEQGGMADGL
RERELEEIRTKLRLQAQSLSSVGPRLASEYLSPEEMVTFKKTKRRVKKIRKKEKEVIMRA
DDLLPLGDQTQDGDFGSRLRGRGRRRVPEVEEEALEDEEKDPVAQPPPSDDTRVENMDIS
DEEDGGALPPGSPEGLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVLEIVKKLES
RQRGWEEEEDPERKGTIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANG
GSESDGEENIGWSTVNLDEEKQHQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETT
VQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVD
ETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQE
KQKAQKTPYIVLSGSGKSMNANTITK
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggggtcgtcaaagaagcaccgtggcgagaaggaggcggccgggacgacggctgcggcc
gggactgggggcacgaccgagcagccgccacggcatcgcgagcataagaaacacaagcac
cggagcagcggcggcggcagcagcggcggcgaacgacggaagcggagccgggagcgtggg
agtgagcgcgggagcgggcggcgtggggcggaagccgaggcccgcagcggcgcgcacggt
cgcgaacgaagccaagcggagccctcggagcggcgcgtgaagcgggagaaacgcgatgac
ggctacgaggccgctgccagctccaaagccagctctggcgatgcctcatccctcagcatt
gaggagaccaataaactccgagcaaagttggggctgaagcccttggaggtcaatgctgtt
aagaaagaggcgggcaccaaggaggagcccgtggcagccgatgttatcaaccccatggcc
ttgcgacagcgggaagaactgcgggagaagctggcagctgccaaggaaaaacgcttgctg
aaccaaaaattggggaaaataaagacactgggggaggatgacccctggctggatgatact
gcagcctggatagagaggagccggcagctacagaaagagaaggacctggcagagaagcgg
gctaagctactagaggagatggaccaagagtttggtgtgagcactttagtggaggaggag
tttgagcagaggcgacaggacctgtacagtgcccgggacctgcaaggcctcactgtggaa
catgccatcgattcttttcgagaaggggagactgtggtcctcaccctcaaggacaaaggg
gtactgcaggacggggaggacgtgctggtgaatgtgaacatggtggacaaggagcgggcg
gacaagaacgtggagcttcggaaaaagaagcctgactacctgccctatgcggaagatgag
agtgtggacgatttggcacagcaaaaacctcgttctatcctggccaaatatgatgaggaa
ctggagggcgagcgaccacattccttccgtctggagcagggtgggatggccgatggcctg
agggaacgagagttagaagaaatccgcaccaagctacggctgcaggctcagtctctgagc
tccgtagggccccggcttgcctctgagtacctcagtcccgaggagatggtgaccttcaag
aagaccaaacggagagtgaagaaaatccgaaagaaggagaaggaggtgataatgcgggca
gatgacttgctgcccctgggcgaccagactcaggatggggactttggatccaggctccgg
ggccggggtcggcgccgagttcctgaggtggaggaggaggcccttgaggatgaggagaag
gaccctgtggcccagccgccaccatcggatgacactcgagtagagaacatggacatcagt
gatgaagaggatgggggagctcttccgccagggtccccagaggggctggaggaagacgag
gcagagctggagctgcagaagcagctggagaaggggcgccggctgcggcagctgcagcaa
ctgcagcagctccgagacagtggtgagaaggtgctggagattgtgaagaaactggagtct
cgccagcgcggctgggaggaggaggaggaccctgagaggaaggggaccatcgtgttcaat
gccacttctgaattctgccgcacgctgggggagatccccacctacgggttggctggcaac
cgcgaggagcaggaagagctcatggactttgaaagggatgaggagcgctcggccaacggt
ggctctgaatcagatggggaagagaacattggctggagcaccgtcaacctggatgaggag
aagcagcatcaggatttctctgcttcctctaccaccatcctggatgaggagcccatcgtg
aacagagggctggctgctgccctgctcctgtgtcagaacaaaggactgctggagaccaca
gtacaaaaggtggcccgggtgaaggctcccaataagtcactgccctcagcagtgtactgc
atcgaggataagatggccattgatgacaagtacagccgacgggaggagtacaggggcttc
acccaggacttcaaggagaaagatggctacaagcctgatgttaagattgaatacgtggat
gagacgggcaggaaactgactcccaaggaggcattccggcagctgtcccaccgcttccac
ggaaagggctcaggcaagatgaagactgagcggcggatgaagaagctggatgaggaggcg
ctcctgaagaaaatgagctccagtgacacgcccctgggcaccgtggcactgctccaggag
aagcagaaggcccagaagacaccgtatatcgtgctcagtggcagtggcaagagcatgaat
gcgaacaccatcaccaaatga

DBGET integrated database retrieval system