KEGG   Mus musculus (mouse): 20238
Entry
20238             CDS       T01002                                 

Gene name
Atxn1, 2900016G23Rik, Atx, Atx1, C85907, Gm10786, Sc, Sca1
Definition
(RefSeq) ataxin 1
  KO
K23616  ataxin 1/1L
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    20238 (Atxn1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    20238 (Atxn1)
   05022 Pathways of neurodegeneration - multiple diseases
    20238 (Atxn1)
SSDB
Motif
Pfam: ATXN-1_C AXH PGC7_Stella
Other DBs
NCBI-GeneID: 20238
NCBI-ProteinID: NP_001186233
MGI: 104783
Ensembl: ENSMUSG00000046876
UniProt: P54254
Position
13 A5; 13 21.98 cM
AA seq 791 aa
MKSNQERSNECLPPKKREIPATSRPSEEKATALPSDNHCVEGVAWLPSTPGIRGHGGGRH
GSAGTSGEHGLQGMGLHKALSAGLDYSPPSAPRSVPTANTLPTVYPPPQSGTPVSPVQYA
HLSHTFQFIGSSQYSGPYAGFIPSQLISPSGNPVTSAVASAAGATTPSQRSQLEAYSTLL
ANMGSLSQAPGHKVEPPPQQHLSRAAGLVNPGSPPPPTQQNQYIHISSSPQSSGRATSPP
PIPVHLHPHQTMIPHTLTLGPSSQVVVQYSDAGGHFVPRESTKKAESSRLQQAMQAKEVL
NGEMEKSRRYGASSSVELSLGKASSKSVPHPYESRHVVVHPSPADYSSRDTSGVRGSVMV
LPNSSTPSADLEAQQTTHREASPSTLNDKSGLHLGKPGHRSYALSPHTVIQTTHSASEPL
PVGLPATAFYAGTQPPVIGYLSGQQQAITYAGGLPQHLVIPGNQPLLIPVGSPDMDTPGA
ASAIVTSSPQFAAVPHTFVTTALPKSENFNPEALVTQAAYPAMVQAQIHLPVVQSVASPT
TASPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEESHSP
GVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCIS
LTLKNLKNGSVKKGQPVDPASVLLKQAKTDSLAGSRHRYAEQENGINQGSAQVLSENGEL
KFPEKIGLPAAPFLSKIEPSKPTATRKRRWSAPETRKLEKSEDEPPLTLPKPSLIPQEVK
ICIEGRSNVGK
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgaaatccaaccaagagcggagcaacgaatgcctgcctcccaagaaacgtgagatcccc
gccaccagccggccctcggaggagaaggccactgctctgcccagcgacaaccactgcgtg
gagggtgtggcctggctccccagcacccctggcatccgcggccatgggggtgggcggcac
gggtcagcagggacttccggggagcatggtttacaaggaatgggtttacataaagcactg
tccgcagggctggattactccccacccagtgcccccaggtcagtccccacagccaacacg
ctgcccaccgtgtaccctcctcctcagtcagggaccccggtgtctcctgtgcagtacgcc
cacctttcgcataccttccagttcattgggtcctcccaatacagtgggccttacgcgggc
tttatcccttcccagctgatctccccatcaggcaacccggtcaccagtgcagtagcctca
gctgcaggggccaccactccatcacagcgctcccagctggaggcttattccaccctgctg
gccaacatgggcagtctgagccaggcaccaggacataaggttgagccccctccgcagcag
cacctcagcagggctgcaggattagtcaacccggggtcccctcctccacccacccagcag
aaccagtacatccatatttccagctctccacagagctccgggcgggcgacatctccccca
cccatcccggtccacctccatccccatcagacgatgatcccgcacacactcaccctgggg
ccttcatcccaggtggttgtgcaatatagtgatgccggaggccactttgttcctcgagag
tccaccaaaaaagccgagagcagcaggttgcagcaggctatgcaagccaaggaagtcctg
aatggggagatggagaaaagccggaggtatggggcatcatcttctgtggagctgagccta
ggcaaggcaagcagtaagtcagtgcctcatccctatgagtccaggcatgtggtggtccac
ccaagcccagcagactacagcagtcgtgatacctccggggtccgtggatctgtgatggtt
ctgcctaatagcagcacaccctcagccgacctggaggcccagcagaccacgcatcgagag
gcctccccatccaccctcaatgacaagagcggcctgcacctagggaagccgggccacagg
tcttatgcgctgtccccccacacggtcattcagaccacacacagtgcatcagagcctctc
ccggtgggcctaccagccacggccttctacgctggcactcaacctcctgtcatcggctac
ctgagcggccagcagcaagcaatcacctatgctggtggtctgccgcagcacctggtgatc
ccaggtaaccagcccctgctcatcccggtgggcagccctgacatggacacgcctggggca
gcctcggccatcgtgacgtcatcaccccagtttgctgcagtacctcacacgtttgtcacc
accgccctgcccaagagcgagaacttcaacccagaggctctggtcacccaggctgcctac
ccagccatggtgcaggcccagatccacctgccggtggtgcagtccgtggcgtcccccacc
acggcgtctcccacgctgccgccatatttcatgaaaggctccatcatccagctggccaac
ggggagctgaagaaggtggaggacctgaagacggaggatttcatccagagtgcagagatt
agcaatgacctcaagatcgactccagtactgtggagagaatcgaggagagccacagcccc
ggggtggccgtgatacagtttgctgttggtgaacaccgagcccaggtcagtgtcgaagtc
ttggtagagtatcctttttttgtatttggacagggctggtcatcctgctgtcctgagcgg
accagccagctctttgatctgccgtgttccaaactctctgttggggacgtctgcatctcg
ctcaccctcaagaacctgaagaatggctctgttaaaaagggccagcctgtggaccctgcc
agcgtcctgctgaagcaggcaaagaccgacagcctggctggcagcagacacagatacgcg
gagcaggaaaacggaatcaaccagggaagcgcccaggtgctctctgagaatggcgaactg
aagtttccagaaaaaataggattgcctgcagcacccttcctcagcaaaatagaaccgagc
aaacccacagccacgaggaagaggaggtggtcggcgccggagacccgtaaactggagaag
tcggaggacgagccacctttgactcttcccaagccttcgctcattcctcaggaggttaag
atctgcatcgaaggccgatctaacgtgggcaagtag

KEGG   Mus musculus (mouse): 52335
Entry
52335             CDS       T01002                                 

Gene name
Atxn1l, AW558552, Bo, Boat, C330011L24Rik, D6Mgi3, D6Mgi37, D8Ertd587, D8Ertd587e
Definition
(RefSeq) ataxin 1-like
  KO
K23616  ataxin 1/1L
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    52335 (Atxn1l)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    52335 (Atxn1l)
   05022 Pathways of neurodegeneration - multiple diseases
    52335 (Atxn1l)
SSDB
Motif
Pfam: AXH ATXN-1_C
Other DBs
NCBI-GeneID: 52335
NCBI-ProteinID: NP_001074399
MGI: 3694797
Ensembl: ENSMUSG00000069895
Vega: OTTMUSG00000061923
UniProt: P0C7T6
Position
8 D3; 8 57.22 cM
AA seq 687 aa
MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQTGAR
VSLGGDGTEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTFNVASSLIQHP
GIHYPPVHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATTHLPHFVPYASL
LAEEATPPPQAASPAQSFNKSSSATSPPGQLPHHSNTQPLDLAPGRMPIYYQMSRLPAGY
TLHETSTAGASPILTPQEGQSALEAAAANGQRQRERNVRRESEALDSASSKGESQGLVPV
VECMADGQLFSGSQTPRVEVAAPAHRGTPDTDLEVQRVVGALASQDYRVVAAQRKDEPSP
LNLSHHNLDHQGEGRGSARNPTELVEKSQARVFYPQSHQEPVKHRPLPKAMVVANGNLVP
TGTDPSLLPVGSEILVASSLDLQARATFPDKEPTPPPVTSSHLPSHFMKGAIIQLATGEL
KRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPE
HPFFVYGQGWSSCSPGRTAQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPGQLG
TPRERPERTVLGPRDLCDSEGKNQPSGEGSRVGEPSQPEPGAQACWPAPSFQRFSMQGEE
ARAAMLRPSFIPQEVKLSIEGRSNAGK
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgaaacctgttcatgagcggagtcaggaatgccttccaccaaagaaacgagacctccct
gtgaccagcgaggatatggggagaactaccagctgctccacaaaccacacaccctccagt
gacgcttctgaatggtcccgaggggttgtggtggctgggcagagccagacgggagccaga
gtcagcctcgggggtgatggaactgaggccatcactggcctgacagtagatcagtatggc
atgctgtacaaggtggctgtgccacctgccaccttctcaccaactggcctgccatctgtt
gtgaacatgagccccttaccccccacatttaatgtagcgtcttcactgattcaacatccg
ggaatccactatcccccagtccactatgctcagctcccatccacctcactgcagtttatt
gggtctccatacagccttccttatgctgtgccacctaatttcctacccagtcctctcctc
tctccttctgccaaccttgccaccactcaccttccacactttgtgccatatgcctctctc
ctcgcagaagaagctactccccctccacaggccgcatccccagctcagtcatttaacaag
tcctcatctgccacctccccgcccggccagttgccacatcactcgaatactcaaccactg
gatcttgctccaggccggatgcccatttattatcaaatgtctaggctacctgctggatat
accttgcatgaaacttcaacagcaggtgccagccccattcttactcctcaggagggccag
tctgctctggaagcagctgctgccaatggacagagacaacgagagcgaaatgtaagacgc
gaaagtgaagcccttgactccgccagcagcaagggtgaaagccaaggactggtgccggtg
gtggaatgcatggcggatggacagttgttttcaggttctcagactccgagagtggaggtg
gcggcgccagcacatcgagggaccccagacaccgacctagaggtccagcgggtagttggc
gctttagcttctcaggactatcgtgtggtggcagctcagaggaaagatgagcccagccct
cttaacctatcccatcataaccttgaccatcagggtgagggacgagggtctgccaggaat
cctacagaactggtggagaaaagtcaggcccgtgtgttctacccgcagtcccatcaggaa
ccagtaaaacacagacctttacccaaagcaatggttgtagccaatggcaacctggtgccc
actggaactgaccctagcctgctgcctgtgggctcagagatcctggtggcatcaagtctg
gacctgcaggccagagccaccttcccagacaaggagccaacgccacctcccgttacctct
tcccacctgccctcccatttcatgaaaggcgccatcattcagctggctacaggggagctg
aagcgggtagaggacctccagacccaggattttgtgcgaagtgcggaagtgagtgggggg
ctgaaaattgactctagcacagtcgtggacattcaggagagccagtggcctggatttgtt
atgctgcatttcgtggttggtgaacagcagagcaaagtgagcattgaggtgccccctgag
caccctttttttgtatatggccagggttggtcctcctgcagccctgggcggactgcacaa
ctcttctctctgccctgccatcggctacaggtgggagatgtctgcatctctatcagttta
cagagcttgaacagtaactcagtatctcaggccagctgtgctcccccagggcagctgggt
acaccccgagaaaggcctgagaggacagtcttggggcccagagacctatgtgacagcgag
gggaagaaccagccttcaggagagggttcccgggtgggagaaccctcccagcctgagcct
ggtgctcaggcctgctggccagccccaagcttccaaagattcagcatgcaaggggaggag
gcacgggctgcgatgctccgtccctctttcattccacaggaggtaaagctgtccatcgaa
gggcgttccaatgcaggaaaatga

DBGET integrated database retrieval system