KEGG   Mus musculus (mouse): 20249
Entry
20249             CDS       T01002                                 

Gene name
Scd1, AA589638, AI265570, Scd, Scd-1, ab
Definition
(RefSeq) stearoyl-Coenzyme A desaturase 1
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    20249 (Scd1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    20249 (Scd1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    20249 (Scd1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    20249 (Scd1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     20249 (Scd1)
Lipid biosynthesis proteins [BR:mmu01004]
 Desaturase
  First
   20249 (Scd1)
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-GeneID: 20249
NCBI-ProteinID: NP_033153
MGI: 98239
Ensembl: ENSMUSG00000037071
UniProt: P13516 Q547C4
Structure
PDB: 
4YMK

Position
19 C3; 19 37.98 cM
AA seq 355 aa
MPAHMLQEISSSYTTTTTITAPPSGNEREKVKTVPLHLEEDIRPEMKEDIHDPTYQDEEG
PPPKLEYVWRNIILMVLLHLGGLYGIILVPSCKLYTCLFGIFYYMTSALGITAGAHRLWS
HRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGW
LLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFVN
SLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTF
PFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDGSHKSS
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgccggcccacatgctccaagagatctccagttcttacacgaccaccaccaccatcact
gcacctccctccggaaatgaacgagagaaggtgaagacggtgcccctccacctggaagaa
gacatccgtcctgaaatgaaagaagatattcacgaccccacctatcaggatgaggaggga
cccccgcccaagctggagtacgtctggaggaacatcattctcatggtcctgctgcacttg
ggaggcctgtacgggatcatactggttccctcctgcaagctctacacctgcctcttcggg
attttctactacatgaccagcgctctgggcatcacagccggggctcatcgcctctggagc
cacagaacttacaaggcacggctgcccctgcggatcttccttatcattgccaacaccatg
gcgttccagaatgacgtgtacgaatgggcccgagatcaccgcgcccaccacaagttctca
gaaacacacgccgaccctcacaattcccgccgtggcttcttcttctctcacgtgggttgg
ctgcttgtgcgcaaacacccggctgtcaaagagaagggcggaaaactggacatgtctgac
ctgaaagccgagaagctggtgatgttccagaggaggtactacaagcccggcctcctgctg
atgtgcttcatcctgcccacgctggtgccctggtactgctggggcgagacttttgtaaac
agcctgttcgttagcaccttcttgcgatacactctggtgctcaacgccacctggctggtg
aacagtgccgcgcatctctatggatatcgcccctacgacaagaacattcaatcccgggag
aatatcctggtttccctgggtgccgtgggcgagggcttccacaactaccaccacaccttc
cccttcgactactctgccagtgagtaccgctggcacatcaacttcaccacgttcttcatc
gactgcatggctgccctgggcctggcttacgaccggaagaaagtttctaaggctactgtc
ttagccaggattaagagaactggagacgggagtcacaagagtagctga

DBGET integrated database retrieval system