KEGG   Mus musculus (house mouse): 20255
Entry
20255             CDS       T01002                                 
Symbol
Scg3, 1B1075, AI385542, Chgd, SgIII
Name
(RefSeq) secretogranin III
  KO
K25733  secretogranin-3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    20255 (Scg3)
SSDB
Motif
Pfam: SGIII DUF2680 ACDH_C
Other DBs
NCBI-GeneID: 20255
NCBI-ProteinID: NP_033156
MGI: 103032
Ensembl: ENSMUSG00000032181
UniProt: P47867
Position
9:complement(75550648..75591733)
AA seq 471 aa
MGFLWTGSWILVLVLNSGPIQAFPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKA
FPSESKPSESNYSSVDNLNLLRAITEKETVEKERQSIRSPPFDNQLNVEDADSTKNRKLI
DEYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRGVFDKIVSKLLN
LGLITESQAHTLEDEVAEALQKLISKEANNYEETLDKPTSRTENQDGKIPEKVTPVAAVQ
DGFTNRENDETVSNTLTLSNGLERRTNPHREDDFEELQYFPNFYALLTSIDSEKEAKEKE
TLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDETIALQTKNKLEKNTTDSKSKLFPA
PPEKSQEETDSTKEEAAKMEKEYGSLKDSTKDDNSNLGGKTDEATGKTEAYLEAIRKNIE
WLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKGILDKEEANAIKRIYSSL
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggggttcctttggaccggctcttggatactggtgttggtgctcaacagcggcccaatt
caagctttccccaaacccgaaggcagccaagacaaatccctgcataatagagaattaagt
gcagaaagacctttgaatgaacagatcgctgaggcagaggcagacaagattaaaaaggca
ttcccttcagaaagcaagccgagtgaaagcaattattcttctgtcgataacttgaatctg
ctgagggcaataacagaaaaggaaaccgttgagaaagagagacaatccataagaagcccc
ccgtttgataaccaactgaacgtggaagacgctgattcaaccaaaaatcggaaactgatc
gatgagtacgattccaccaagagtggactggaccacaagtttcaagatgacccagacggc
cttcatcaactggatggaactcctttaactgctgaagacatcgtccataagattgccacc
aggatttatgaggagaacgacagaggagtgtttgacaaaattgtttctaaactgctgaat
cttggcctgatcactgaaagccaggcacatactctggaagatgaagtagcagaagcttta
caaaaactgatttcaaaagaggccaacaattatgaggagaccctggataaacccacaagc
aggaccgagaatcaggatgggaaaataccagagaaagtgactccggtggcagcagtccaa
gatggcttcactaaccgtgaaaacgatgagacggtgtctaacaccttgaccttgtccaat
ggcttggaaaggagaactaacccccacagggaagacgactttgaggaactccagtatttc
cccaacttctatgcactactgacaagcatcgactcagaaaaagaagcaaaagagaaagaa
accctgatcaccatcatgaagacattgattgacttcgtgaaaatgatggtgaaatacggt
acgatatctccagaggaaggcgtgtcctaccttgaaaacttggatgaaacaattgctctg
cagaccaagaacaagctagaaaaaaatactactgatagcaaaagtaagctattcccagct
ccaccagagaagagtcaggaagaaacagacagtaccaaggaagaagccgccaagatggaa
aaggaatacggaagcctaaaagactctacaaaagatgataactccaacctaggaggaaag
acagatgaagccacagggaagacagaagcctacttggaagccattagaaaaaacatcgaa
tggctgaagaaacataacaagaagggcaacaaagaagattacgacctttcaaagatgagg
gactttatcaaccaacaagctgacgcttatgtggagaagggcatcctcgacaaggaagaa
gccaacgccatcaaacgcatctacagcagcctgtga

DBGET integrated database retrieval system