KEGG   Mus musculus (mouse): 20265Help
Entry
20265             CDS       T01002                                 

Gene name
Scn1a, B230332M13, Nav1.1
Definition
(RefSeq) sodium channel, voltage-gated, type I, alpha
  KO
K04833  voltage-gated sodium channel type I alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    20265 (Scn1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    20265 (Scn1a)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   20265 (Scn1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Na_trans_cytopl Na_trans_assoc PKD_channel GPHH ATP-synt_B Zip IQ Pns11_12 CytochromB561_N SieB
Motif
Other DBs
NCBI-GeneID: 20265
NCBI-ProteinID: NP_001300926
MGI: 98246
Ensembl: ENSMUSG00000064329
Vega: OTTMUSG00000013102
UniProt: A2APX8
Position
2 C1.3; 2 39.13 cM
AA seq 2009 aa AA seqDB search
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKI
AIKILVHSLFSMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCL
EDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVQWPPTNASLEEHSIEKNITMDY
NGTLVNETVFEFDWKSYIQDSRYHYFLEGVLDALLCGNSSDAGQCPEGYMCVKAGRNPNY
GYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILA
VVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEAAQQAAATTASEHSREPSAAGRLS
DSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDDDEFHKSESEDSIRRKGFRFSIEG
NRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFED
NESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGGPSVP
TSPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASIL
TNTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHIVNLVVMDPFVDLAITICIVL
NTLFMAMEHYPMTEHFNHVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIV
TLSLVELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAII
VFIFAVVGMQLFGKSYKDCVCKIATDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCM
EVAGQAMCLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMH
KGIAYVKRKIYEFIQQSFVKKQKILDEIKPLDDLNNRKDNCISNHTTEIGKDLDCLKDVN
GTTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEE
SKEKLNESSSSSEGSTVDIGAPAEEQPVIEPEETLEPEACFTEGCVQRFKCCQISVEEGR
GKQWWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFT
YIFILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRA
LRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTT
TGDIFEISEVNNHSDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYA
AVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFM
TEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMV
ETDDQSDYVTSILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMF
LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLV
MFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPD
CDPNKVNPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPL
SEDDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGD
RIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAV
IIQRAYRRHLLKRTVKQASFTYNKNKLKGGANLLVKEDMLIDRINENSITEKTDLTMSTA
ACPPSYDRVTKPIVEKHEQEGKDEKAKGK
NT seq 6030 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaacagtgcttgtaccaccaggacctgacagcttcaacttcttcaccagagaa
tcccttgcagctattgaaaggcgcattgcagaagagaaggctaagaatcccaagccagac
aaaaaagatgatgatgaaaatggcccaaagccaaacagtgacttggaagctgggaagaac
cttccatttatctatggagacattcctccagagatggtgtcggagcctctggaggacctg
gacccctactatatcaataagaagacttttatagtattgaataaagggaaggccatcttc
cggttcagtgccacctccgccctgtacattttaacacccttcaatcctcttaggaaaata
gctattaagattttggtacactcattattcagcatgttaatcatgtgcactattttgaca
aactgtgtatttatgacaatgagtaaccctcccgactggacaaagaatgtggagtacacc
ttcacaggaatatatacttttgaatcactaataaaaattattgcaaggggcttctgttta
gaagattttactttccttcgcgacccatggaactggctggacttcactgtcattacattc
gcatatgtgacggagtttgtggacctgggcaatgtctcagcattgagaacattcagagtt
cttcgagcattgaaaactatttcagtcattccaggcctgaagaccatcgtgggggccctg
atccagtcggtgaagaagctgtctgacgtcatgatactcactgtgttctgtctcagtgtg
ttcgcactcatcgggttgcagctcttcatgggcaacctgaggaataaatgtgtacagtgg
cctcccaccaacgcttcccttgaggaacatagcatagagaagaatataactatggattac
aatggcacacttgtaaatgaaaccgtgttcgagtttgactggaaatcatacattcaagac
tcaagatatcattatttcctggagggtgttttagatgcactgctgtgtggaaatagctct
gatgcaggccaatgtccagaaggatatatgtgtgtaaaagctggtagaaaccctaattat
ggttacacaagctttgataccttcagttgggcatttttgtccctgtttcgactgatgact
caggacttctgggaaaatctataccaactgacattgcgtgctgctggcaaaacctacatg
atattttttgtgctggtcattttcttgggctcattctacctgataaacttgatcctggct
gtggtggccatggcctatgaggagcagaatcaggccacactggaggaggctgaacagaaa
gaggcagaatttcagcagatgttggagcaacttaagaagcagcaagaggctgcacagcag
gcagcggctacaacagcctcagaacattccagggagcccagtgcagcaggcaggctctca
gatagctcttcagaagcctctaagttgagttcgaagagtgctaaagaaagacgaaatcgg
aggaaaaaaaggaaacagaaagagcagtctggaggagaagagaaagatgatgatgaattc
cacaagtctgagtctgaagacagcatcaggaggaaggggtttcgcttctccatagaaggg
aatagactgacatatgaaaagaggtactcttccccgcatcagtctctgttaagcattcgt
ggttccctgttctccccaagacgcaatagcagaacaagtcttttcagctttagagggcga
gccaaggatgtggggtctgagaatgactttgctgatgatgaacacagcacctttgaggat
aatgagagccgtagagactcactgttcgttccccgaagacacggagagcgacgcaacagt
aacctgagccagaccagcaggtcctcccgaatgctggcggtgtttccagccaatgggaag
atgcacagcacggtggattgcaatggtgtggtttccttggttggtggaccctcagttccc
acatcgccagttggacagcttctgccagaggtgataatagataagccagctactgatgac
aatggaacaaccactgaaactgagatgagaaagaggaggtcgagctctttccatgtttcc
atggactttctagaagatccttcccagaggcaaagggcaatgagcatagccagcatctta
acaaatacagtagaagaactagaagaatccaggcagaaatgtccaccctgttggtataaa
ttttccaacatattcttaatttgggactgttctccatattggctgaaagttaaacatatt
gtcaacctggtggtgatggacccatttgttgatctggccattaccatctgcattgtgtta
aatacgctcttcatggctatggagcactaccccatgactgaacatttcaaccatgttctt
acagtgggaaacttggtcttcactgggattttcacagcagaaatgttcctgaaaatcatc
gcaatggatccttactattacttccaagaaggctggaatatctttgatggtttcattgtg
acactcagcctggtagaacttggccttgccaatgtggaaggattgtcagttctccgttca
tttcgactgctccgagtgttcaagttggcaaagtcttggcccacactgaatatgctcatt
aagatcattggtaactcggtgggagcactgggcaacctgactctggtgttggccatcatt
gtctttatttttgccgtggttggcatgcagctgtttggaaaaagttacaaagattgtgtc
tgcaaaattgccactgactgcaaactcccacgttggcacatgaacgacttcttccactcg
ttcctgatcgtgttccgcgtgctgtgtggggagtggatagagaccatgtgggactgcatg
gaggtggcaggacaagctatgtgccttactgtcttcatgatggtcatggtgattgggaac
cttgtggtcttgaacctctttctggccttgcttctgagctcatttagtgcagacaacctt
gcagccactgatgatgacaatgagatgaacaacctgcagattgctgtggacaggatgcac
aaaggaatagcttatgtaaaaagaaaaatatatgaattcattcaacaatcctttgttaag
aaacagaagattctagatgaaattaagccacttgatgatctaaacaacagaaaagacaat
tgtatctctaaccacacaacagaaattgggaaagatctggactgtctgaaagatgtgaat
ggaaccacaagtggcatagggacgggcagcagtgtggagaagtacatcattgatgagagt
gattatatgtcattcataaacaaccccagcctcactgtgactgtgcccattgctgtggga
gagtctgactttgagaacttaaacacagaagactttagcagtgaatcagatctagaagaa
agcaaagagaaactcaacgaaagcagtagctcctcagagggaagcacagtagacattggg
gcgcctgcagaggaacagcctgtcattgaaccagaagaaacccttgagcccgaagcttgc
ttcactgaaggctgtgtccagagattcaagtgctgtcaaatcagcgtggaagaaggaaga
gggaaacagtggtggaacctacggaggacgtgcttccgaatagttgaacacaactggttt
gagaccttcattgtgttcatgattctcctgagtagtggtgccctggcctttgaggatata
tatattgatcagcgaaagacgatcaaaaccatgctggagtatgctgacaaagtcttcact
tacattttcatcctggagatgctcctcaaatgggtggcctatggctatcaaacatacttc
accaatgcctggtgttggctagacttcttaattgttgatgtttcattggtcagtttaaca
gcaaatgccttgggttactctgaactcggggccatcaaatccctaaggacactaagagct
ctgagacccctaagagccttatcacgatttgaagggatgagggtggttgtgaatgccctg
ttaggagcaattccatccatcatgaatgtgcttctggtttgccttatattctggctaatt
ttcagcatcatgggcgtaaatttgtttgctggcaaattctaccactgtgttaacaccaca
actggtgacatatttgagatcagcgaagtcaataatcattctgattgcctaaaactaata
gaaagaaatgagaccgcccggtggaaaaatgtgaaagtaaactttgataatgtaggattt
gggtatctttctttgcttcaagttgccacatttaagggctggatggatatcatgtatgct
gcagttgattccagaaatgttgaactacagcctaagtatgaggaaagcctgtacatgtat
ttgtacttcgtcatcttcatcatcttcgggtccttctttaccctgaacctgtttattggt
gtcattatcgacaatttcaaccagcaaaagaagaagtttggaggtcaagacatctttatg
acagaagaacagaagaaatactataatgcaatgaagaaattaggatcaaaaaagccacaa
aagcctatccctcgacctggaaacaaatttcaaggaatggtttttgactttgtaaccaga
caagtgtttgatatcagcatcatgatcctcatctgtctgaacatggtgaccatgatggtg
gaaacggatgaccagagcgattatgtgacaagcattttgtcacgcatcaacctggtgttc
atcgtcctgttcaccggcgagtgtgtgctcaagctcatctcgctccgccattattatttc
accattggatggaacattttcgattttgtggtggtcatcctctccattgtagggatgttt
cttgcggagctaatagaaaagtattttgtgtctcctaccctgttccgagtcatccgcctg
gccaggattggacgaatcctacgcctgatcaaaggtgccaaggggatccgcacgctgctc
tttgctctgatgatgtcccttcctgcgctgtttaacatcggcctcctgctttttctcgtc
atgttcatctacgccatctttgggatgtccaactttgcctatgttaagagggaagttggg
attgatgacatgttcaactttgagaccttcggcaacagcatgatctgcctgttccaaatc
accacctctgcgggctgggatggactgctggcccccatcctcaacagcaaaccccctgac
tgtgaccctaataaagttaaccctggaagctcggtgaagggagactgtgggaacccatct
gtggggattttcttttttgtcagctacatcatcatatccttcctggttgtggtgaacatg
tacattgctgtcatcctggagaacttcagcgttgccacagaagaaagtgcagagcctctg
agtgaggacgactttgagatgttctacgaggtctgggagaagttcgaccctgacgccacc
cagttcatggaatttgaaaaattatctcagtttgcagctgctctagaaccccctctcaat
ttgccacaaccaaacaaacttcagctcattgccatggacctgcccatggtgagtggagac
cgcatccactgcctggacatcttatttgcttttacaaagcgggtgttgggtgagagtgga
gagatggatgctcttcgaatccagatggaagagcggttcatggcttccaacccctccaag
gtctcttatcagcccatcactactacattaaaacgcaaacaagaggaggtgtcagctgtt
atcattcagcgagcttataggcgccaccttttgaagcgaacagtaaaacaagcttcattc
acatacaataagaacaaactcaaaggtggggctaatcttcttgtaaaagaagacatgctc
attgacagaataaacgaaaactctattacggagaaaactgacctgacaatgtccacagca
gcttgtccgccctcctacgatcgggtgacaaagccaatcgtggagaaacacgagcaggaa
gggaaggatgaaaaagccaaagggaaatga

DBGET integrated database retrieval system