KEGG   Mus musculus (mouse): 20272
Entry
20272             CDS       T01002                                 

Symbol
Scn7a, 1110034K09Rik, AI642000, N, NaG, Nav, Nav2, Nav2.3, Nax, Sc, Scn6a
Name
(RefSeq) sodium channel, voltage-gated, type VII, alpha
  KO
K04839  voltage-gated sodium channel type VII alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    20272 (Scn7a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    20272 (Scn7a)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   20272 (Scn7a)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc GPHH IQ
Other DBs
NCBI-GeneID: 20272
NCBI-ProteinID: NP_033161
MGI: 102965
Ensembl: ENSMUSG00000034810
Vega: OTTMUSG00000013100
UniProt: Q62467 B1AYL1
Position
2 C1.3; 2 39.21 cM
AA seq 1681 aa
MLTSPEPKGLVPFTTESLELIENHIAKKCNEDPEEEEGLKPSRNLEAGKRLPIPYGTLPR
GTVSEPLEDVDPYYYVKRNTFMVLNRSRVIFRFNAVSIFCTLSPLNSLRRAAIKALVHPL
FRLLILISVLTDSILMCMSNLPEWILAIENTLLGIYAFEILVKVIARGIWAGSFSFLGDL
WNWLDFSVTLFELITRFSPLSSFLMLKTIRTFRILKIIPLNHGLQSIVMTLAQCLKKLFG
AIALALFFLAVFSLLGMGLFMGNLKHKCLRWPEENENETLHNRTGSLNYSPERINFYYME
GAKYALLCGNRTDAGQCPEGYVCVKEGTNPDNGFTSFDNFGWSLLAMFRLMTQDYPELLY
HQILYASGKVYMIFFVMISFWFAFYLTSLFLGILTMTYEKEKQRACEESGGLDPKCQQTV
KELDEENDAAEMETTQIEMKKRSPTSINTTLDILEDTTLGHREEPETSRKKCPICWHKFI
KTCFIWKCSPCWVKLNEFADRVITHPLADLFLVICIVLNICFLALEHFPMSEELRSLLHV
GNLVFIGIYTIEMILKIIAMHPYGYFQISWNIFDSILVVLELTEILLADVEGLAVLITVP
LIFIKLGKYGPPFKSLMRILGSSLMALKDLVLLLCIFVYFSAVFGMKLFGRSYKDCVCHI
KEDCQPQRWHMSDFLHAYMTVFRILCGEWIETLWECMEVAGQAWCIPFYMMVILIGNLLI
LYLFVTLVSSFSYYDATSEVNKEAKNLQLAMARIKSGINSMLLKLMCTERSVPTEATDQI
CDPSVKENISGHTLSELSNTQTFLRYKDQSSSTEKTPVTESESQSLIASPSASETVPIAS
GESDIENLDNKETRSKSGNGGSKEKMKQSSSSECSTVDIAISEEEEMVYEHEKSKLHKNG
YERKSSTGQISRESRNGKIWKNIRKTCCKIVENSWFECFIGLVTLLCTGTLALEDIYIDQ
RKTTKILLEYADMIFAYIFILEMLLKWVAYGFKAFFSNNWYKLDFMVVIVFCLSLIGKTR
EDLNPLTSIKFLRALRVLSQFERMKVVLRALIKTTLPTVSVFLVCLMIWLLFSVIGVQLF
AGKFYECIDPTKGERFPVFEVMNKSQCEKLLFNESMPWENAKLNFDNVGNGFLSLLQVAT
FNGWISIMNSAIDSVGVNMQPSFEYNLYMYSYFIIFVIFGLFLPLCMLIGVIIRNFNKQK
IKQGGSNIFITVKQKKQYRALKKLLYADVQKPTPRPRNKFQGFLFDLVTHRVFNVIIILL
ICFQATTIMIQKDEQSPQMETAIFWMNSIFVMLFTLECILKLTAFRCHYFTSAWNVHDFM
VVIFSITGLLLPLTIGQYFVPPSLVQLILLSRVIHILRPGKGPKVFHDLMLPLILALPAL
LNISLLIFLVMFIYAIFGMYNFAYVKKEAGINDVSNFETFGSSMLCLFQVTTFSGWDGML
DAIFNSQWSDCDPDKINPGTQVKGDCGSPSVGISYFVSYILISWLIIVNMYIVLIMEFLS
IPSQKKSRTLSEDDFRRFFRVWNRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLV
AMDLPMAAGDRIHCLDILLAFTKRVMGKDERVEKILSEIESGFMLANPFKITYEPITTTL
KRKQEAVSATIIQRAYKSYRLRQNDKNVSDTPAIDDRRDDLTSKGAHSGKIEEKASIQTQ
I
NT seq 5046 nt   +upstreamnt  +downstreamnt
atgttgacttccccagagccgaagggccttgtcccatttacaacagagtcacttgaactt
atagaaaatcacattgctaaaaaatgcaatgaagaccccgaagaagaagaaggtttaaaa
ccaagtcgtaatctagaagctggcaaaagacttccaattccctatggaaccctccctcga
ggaaccgtgtcagagcccttggaagatgtggatccatactactatgttaagagaaatact
ttcatggtcttaaacagaagcagagtcatcttcaggttcaatgcggtttccatcttctgc
acattgtctcctctaaactccctcagaagagcagctatcaaggctttggtgcatcccctt
tttcgcctgctgattttaatcagcgttctcactgacagcatacttatgtgcatgagtaat
ctaccagaatggatattggcaatagagaatactttgcttgggatttacgcatttgaaata
cttgtaaaagtcattgcaagaggtatctgggcaggttcattttccttccttggggatctt
tggaactggcttgatttcagtgtaactttgttcgagctaatcacaaggttttcacctcta
agctcctttttaatgcttaaaactatcagaactttccgaattttgaagattatccctttg
aaccacggcctgcagtctattgtgatgacactggcccagtgtttgaagaaactatttggt
gccattgccctagctctgttttttctggctgtgttttcactacttggaatgggcctcttc
atgggcaacctgaagcacaaatgtctgcggtggccagaagaaaatgaaaatgaaacgctg
cacaacagaactggaagccttaactatagtccagaaagaataaacttctactacatggaa
ggagcgaaatatgctctcctttgcggcaacaggacagatgctggccagtgtccggaaggt
tatgtgtgtgtaaaagaaggcacaaatcctgacaatggcttcacaagttttgacaacttt
ggctggtcccttcttgctatgtttcgattgatgacacaggattaccctgaattactttat
caccagatcctttatgcttcaggaaaggtctacatgatattttttgttatgatcagtttc
tggtttgccttctatttgacaagtttgttcttgggcatactcactatgacctatgaaaag
gaaaagcagagagcctgtgaggaatctggaggccttgatcccaaatgtcaacagacagtg
aaagaactcgacgaagaaaatgacgcagctgagatggaaactacacaaatagaaatgaag
aaaagatccccaacttctataaacaccacactggatatactggaagacactaccctcgga
cacagagaagaaccagaaacatccaggaagaaatgcccaatatgttggcataagtttatt
aaaacctgcttcatctggaaatgctctccctgttgggtaaaactgaacgagtttgctgat
agagttataacacacccattggctgatctttttcttgtcatctgcatcgttttaaacata
tgcttcctcgccctagaacattttccaatgagcgaggagctcaggtctctccttcacgtt
ggaaatttggtttttattggaatttacacaatagaaatgattttgaagataatcgctatg
catccatatgggtattttcaaataagctggaatatttttgacagtatacttgtggttttg
gagttaacagaaattttactagcagatgttgaaggactagctgttttaataacagtccca
ttgatatttataaaactggggaagtacggaccaccatttaagagtttgatgcgcatcctt
ggtagctcattgatggccctgaaagatttggtcctgttgctctgcatattcgtttacttc
tctgctgtgttcggcatgaagctgtttggtcgaagttacaaggattgtgtctgccacata
aaggaagactgccaaccccaacgctggcacatgagtgacttccttcatgcctacatgacc
gtgttccgaatcctctgtggagagtggatagagacattatgggagtgtatggaggttgca
ggccaggcctggtgtattcctttttacatgatggtcattttaattggaaacttattgata
ctttacctctttgtgacattggtgagctctttcagttactatgatgctacatcggaagtg
aacaaagaagccaaaaaccttcagcttgccatggcaaggataaagtcgggaataaactcc
atgcttcttaaattaatgtgcacagaaagaagtgttcctacagaagcaacagaccaaata
tgtgatccaagtgttaaagagaatatttctggccatactctttctgaactgagcaacacc
caaactttcctcagatataaggaccagagcagcagcactgagaaaactccagtgactgaa
tctgagagtcaatctctgattgctagtcccagtgcctctgaaactgtgccgattgcttca
ggagaatctgatatagaaaatctggataacaaggagactcggagcaagtctgggaatgga
ggcagtaaagagaaaatgaagcagtctagctcatctgagtgcagcacagttgatatcgct
atttctgaagaagaagaaatggtctatgaacatgaaaagtcaaagcttcataaaaatggt
tatgaacgcaaatcttcaactggtcaaatcagtagagaatctaggaatggaaagatttgg
aaaaacatcaggaaaacttgctgcaagatagtagagaacagctggtttgagtgtttcatt
ggcctggtcactctgctctgcacaggcactctggctcttgaagacatatatattgatcag
agaaaaaccactaaaatcttactggaatatgcggacatgatatttgcatacatcttcatt
ctggagatgcttctcaagtgggtggcttatggctttaaagcctttttctccaacaactgg
tacaaactggactttatggttgttatcgtgttttgtcttagcttaataggcaaaactcga
gaagatctgaaccctctgacatcaataaagttccttcgagcactaagagttctgtcgcag
tttgaaagaatgaaggtggtcctgagagctttgataaaaacaaccttacccactgtgagc
gtgtttctagtctgcctaatgatctggctgcttttcagtgttattggagtgcagttattt
gctggcaagttctatgaatgcattgacccaacaaagggagaaagattccctgtatttgaa
gttatgaataaaagtcagtgtgaaaaactgttattcaatgaatcaatgccgtgggagaat
gcaaaactgaactttgataatgttggaaatggttttctttctttactccaagtggcaaca
tttaatggatggatcagtattatgaattcagcaattgattctgttggtgtaaacatgcag
cccagctttgagtacaacctctacatgtatagttactttatcatctttgttatctttgga
ttatttcttcctctctgtatgctgattggtgttattattcgcaatttcaacaagcagaaa
attaagcagggaggatcaaacatctttataacagtaaaacagaaaaaacagtaccgggcc
ctgaagaagctcttgtatgcagacgtccagaaaccaacaccccgccccagaaacaaattc
caaggcttcctttttgacctagtaacacaccgtgtctttaatgttatcatcatacttctt
atctgtttccaagcaacaaccattatgatacaaaaggatgagcagagtccacaaatggaa
actgccatcttctggatgaactccatttttgtcatgctgttcactctggaatgcatactg
aagctcactgccttccgttgccactacttcaccagtgcatggaatgttcatgactttatg
gtggtcattttctccattacagggctgctgctacccttgacaataggacaatactttgtg
cctccttccctggtgcagctgattcttctctctcgagtcatccacatcctgcgtcctggg
aaaggaccgaaggtgttccatgacctgatgcttcccttgattctggcgctcccagcattg
ctgaacattagtcttctcatcttcctggtcatgttcatctacgccatctttggaatgtac
aactttgcctatgtaaagaaagaagccggaattaatgatgtgtccaactttgagaccttt
ggaagcagtatgctctgtctcttccaagttacaacgttttctggttgggacgggatgctg
gatgcaattttcaacagtcagtggtctgactgcgatcctgataaaattaatccagggact
caggtcaagggagattgtgggagcccttctgttgggatttcttattttgtcagttacatc
ctcatatcatggttgatcattgttaacatgtacattgtgttgatcatggagttcttaagt
attccttctcagaaaaaaagcaggaccttgagtgaagatgactttaggagattcttccgg
gtgtggaacaggtttgaccctgataggacccagtacatagactctagcaagctttctgat
tttgcagctgctctggatcctcctcttttcatggcaaaaccaaacaagggccagcttgtg
gccatggatctccccatggctgcgggagacagaatccactgcctcgacattttacttgcc
tttacgaaaagagtgatgggaaaggatgagagggtggagaaaatcctttcagagatagaa
tccgggttcatgttagcgaaccctttcaaaatcacttatgagccgattacaactactttg
aaacgcaaacaagaggcagtttcagcaaccatcatccagcgtgcatataaaagctaccgc
ttaaggcaaaatgacaagaatgtatcagatactcctgctatagatgaccgcagagatgat
cttacttctaaaggtgctcactctggcaaaatcgaggagaaggcatctattcagacccag
atttaa

DBGET integrated database retrieval system