KEGG   Mus musculus (mouse): 20278
Entry
20278             CDS       T01002                                 

Gene name
Scnn1g, SCNEG
Definition
(RefSeq) sodium channel, nonvoltage-gated 1 gamma
  KO
K04827  amiloride-sensitive sodium channel subunit gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04742  Taste transduction
mmu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    20278 (Scnn1g)
  09157 Sensory system
   04742 Taste transduction
    20278 (Scnn1g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    20278 (Scnn1g)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Epithelial sodium channel (ENaC)
   20278 (Scnn1g)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 20278
NCBI-ProteinID: NP_035456
MGI: 104695
Ensembl: ENSMUSG00000000216
Vega: OTTMUSG00000024632
UniProt: Q9WU39
Position
7 F2; 7 65.07 cM
AA seq 655 aa
MAPGEKIKAKIKKNLPVRGPQAPTIKDLMHWYCLNTNTHGCRRIVVSRGRLRRLLWIAFT
LTAVALIIWQCALLVFSFYTVSVSIKVHFQKLDFPAVTICNINPYKYSAVSDLLTDLDSE
TKQALLSLYGVKDVLDSTPRKRREAGSMRSTWEGTPPRFLNLIPLLVFNENEKGKARDFF
TGRKRKISGKIIHKASNVMHVHESKKLVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHY
MNIMAQVPLEKKINMSYSAEELLVTCFFDGMSCDARNFTLFHHPMYGNCYTFNNRENATI
LSTSMGGSEYGLQVILYINEDEYNPFLVSSTGAKVLVHQQNEYPFIEDVGTEIETAMSTS
IGMHLTESFKLSEPYSQCTEDGSDVPVTNIYNAAYSLQICLYSCFQTKMVEKCGCAQYSQ
PLPPAANYCNYQQHPNWMYCYYQLYQAFVREELGCQSVCKQSCSFKEWTLTTSLAQWPSE
ASEKWLLNVLTWDQSQQINKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQ
LGLWMSCSVVCVIEIIEVFFIDFFSIIARRQWQKAKDWWARRRTPPSTETPSSQQGQDNP
ALDTDDDLPTFTSAMRLPPAPEAPVPGTPPPRYNTLRLDSAFSSQLTDTQLTNEF
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggcgcctggagagaagatcaaagccaaaatcaaaaagaatctgccagttcgaggcccc
caggcaccgaccattaaggacctgatgcattggtactgcctgaacaccaacacccacggc
tgccggcgcatcgtggtgtcccgaggccgccttcggcgcctgttgtggattgcgttcacg
ctgacagcagtggccctcattatctggcagtgcgccctcctcgtcttctctttctacacc
gtctctgtctccatcaaagtccacttccagaaactggatttccccgctgtcactatctgc
aatatcaacccctacaagtacagtgctgtgagtgacctcctgactgacttggacagtgag
acaaaacaggccttgctgtccttgtatggggtcaaagatgttctagacagtacacctcgg
aaacgccgggaagcaggatccatgcggtccacgtgggaaggcacaccacccagatttctc
aacctgatcccattgttggtcttcaatgagaacgagaagggaaaggccagggacttcttc
actggtcggaagcggaaaatcagtgggaaaatcatacacaaggcttctaatgtcatgcac
gttcatgagtcgaagaaactggtgggatttcagttgtgctcaaatgacacctctgactgt
gccacctacaccttcagctcaggaatcaatgccatccaggagtggtacaaacttcactac
atgaatatcatggcacaggtgcctctagagaagaaaatcaacatgagctattctgccgaa
gaactgctggtgacctgcttcttcgatgggatgtcctgtgatgccaggaacttcactctt
ttccaccatccaatgtatgggaactgctacacgttcaacaacagagaaaacgccaccatc
ctcagcacctccatgggaggcagtgagtatggtctgcaagtcatcttatacataaacgaa
gatgagtacaaccccttcctggtgtcatccactggagccaaggtgcttgtccatcagcag
aatgaataccctttcatcgaagacgtggggaccgagatcgagacagcaatgtccacttcc
ataggaatgcacctgacagaatccttcaagctgagcgaaccttacagccagtgcacagag
gacggcagcgatgtgcccgtcacaaacatctacaatgctgcctattccctccagatctgc
ctttactcatgcttccaaacgaagatggtggaaaaatgtggctgtgcccagtacagtcag
cctctacctccagcagccaattactgcaactaccagcaacaccccaactggatgtattgc
tactaccagctgtaccaggcctttgtccgggaagaactgggctgccaatcagtgtgcaag
caatcctgcagctttaaggaatggacactgaccaccagcttggcacagtggccatctgag
gcttctgagaaatggttgctgaatgttctcacctgggaccaaagccagcaaataaacaaa
aagctcaacaagactgacctggccaagctcttgatattctacaaagacctgaaccaaaga
tccatcatggagagcccagccaacagtattgagatgctcctgtctaactttggtggacag
ctcggcctgtggatgagctgctcggtcgtctgtgtcatcgaaatcatcgaagtcttcttc
attgatttcttctctattattgcccgccgccagtggcagaaagccaaggattggtgggcc
cgtaggcggacaccaccctccactgagactccctccagccagcagggtcaggataatcca
gccctggatacggacgatgatctgcccacttttacctctgctatgcgcctgcctccagcc
ccggaggctccggtgcctggcacaccaccccccagatacaataccttgcgcttggacagt
gccttttcctcccagctcacagacactcagttgaccaatgagttctaa

DBGET integrated database retrieval system