KEGG   Mus musculus (mouse): 20280
Entry
20280             CDS       T01002                                 

Gene name
Scp2, AA409774, AA409893, C76618, C79031, NSL-TP, SC, SCP, SCP-2, SCP-X, SCPX, ns, ns-LTP
Definition
(RefSeq) sterol carrier protein 2, liver
  KO
K08764  sterol carrier protein 2 [EC:2.3.1.176]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00120  Primary bile acid biosynthesis
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
Module
mmu_M00861  beta-Oxidation, peroxisome, VLCFA
mmu_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    20280 (Scp2)
   01040 Biosynthesis of unsaturated fatty acids
    20280 (Scp2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    20280 (Scp2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    20280 (Scp2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.176  propanoyl-CoA C-acyltransferase
     20280 (Scp2)
SSDB
Motif
Pfam: SCP2 Thiolase_N Thiolase_C Alkyl_sulf_C ACP_syn_III Ketoacyl-synt_C SCP2_2 ketoacyl-synt SpoVAD
Other DBs
NCBI-GeneID: 20280
NCBI-ProteinID: NP_035457
MGI: 98254
Ensembl: ENSMUSG00000028603
Vega: OTTMUSG00000009429
UniProt: P32020
Position
4 C7; 4 50.2 cM
AA seq 547 aa
MPSVALKSPRLRRVFVVGVGMTKFMKPGGENSRDYPDMAKEAGQKALEDAQIPYSAVEQA
CVGYVYGDSTSGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAHQLIQGGLANCVLALG
FEKMERGSIGTKFSDRTTPTDKHIEVLIDKYGLSAHPITPQMFGYAGKEHMEKYGTKVEH
FAKIGWKNHKHSVNNTYSQFQDEYSLEEVMKSKPVFDFLTILQCCPTSDGAAAAILSSEE
FVQQYGLQSKAVEIVAQEMMTDLPSTFEEKSIIKVVGYDMSKEAARRCYEKSGLTPNDVD
VIELHDCFSVNELITYEALGLCPEGQGGTLVDRGDNTYGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAVVVTLYRMGFPEAASSFRTHQVS
AAPTSSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKN
GKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQNLQL
QPGKAKL
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgccttctgtcgctttgaaatctccgcgcctgcgccgggtgttcgtggtcggcgttggc
atgaccaagttcatgaagcctggaggtgagaactcaagagactatcctgatatggcaaag
gaagcaggccagaaggcattggaagatgcacagatcccttactccgcagtggaacaggca
tgcgttggctatgtgtatggtgattccaccagtgggcagagggctatctatcatagtttg
ggactgactggcattcctataattaatgtcaacaataactgttctactggttcgactgct
ttgtttatggcccatcaactgattcaaggaggcttggcaaattgtgtgttggctcttggg
tttgagaagatggagaggggatccattggaacaaaattctcagatcggaccactccaact
gataaacatattgaagtcttgatcgataagtatggattgtctgcacatccgattactcct
cagatgtttgggtatgctgggaaagaacatatggaaaaatatggaacaaaagttgaacac
tttgcaaaaattggatggaaaaatcataaacactcagttaataacacgtattcccagttc
caagatgaatacagcttagaagaagtaatgaaatcaaaaccagttttcgattttctgact
atcttgcaatgctgccccacctcagatggtgccgctgccgcgattctgtccagcgaggag
tttgtgcagcagtacggcctgcagtccaaagcggtggagattgtggcccaggagatgatg
actgacttacccagtacgtttgaagagaaaagtattattaaagtggttggctatgatatg
agtaaagaagctgccaggagatgctatgagaagtccggcctgacacccaacgatgtcgac
gtgatagagcttcacgattgcttctctgtcaatgaactcatcacttacgaagcactgggg
ctctgtccagaaggacaaggtggaaccctggtggacagaggggacaacacttacggagga
aagtgggtcatcaaccctagtggaggcctcatctcaaagggacacccactgggcgcaaca
ggtctggctcagtgcgcggagctctgctggcagctgagaggcgaagccggaaagaggcag
gttcccggggcaaaggtggctctgcagcacaatctaggcctcggaggagctgtggttgtc
accctctacaggatgggttttcccgaagctgccagctccttcaggacgcaccaggtttca
gctgctcccaccagctctgcaggggatggattcaaggcaaacctcgtctttaaggagatt
gagaagaagcttgaagaggaaggggaacagttcgtgaagaaaatcggtggcatttttgcc
ttcaaagtgaaagatggccctggaggcaaagaagctacctgggtggtggatgtgaagaat
ggcaaaggatctgtgcttcccaattcagataagaaggctgactgcacaatcaccatggcc
gactcagacttgctggctttgatgactggaaaaatgaaccctcagtcggccttctttcaa
gggaaactgaagattgctggtaacatgggactggccatgaaactacagaaccttcagctt
cagccgggcaaagctaagctgtga

DBGET integrated database retrieval system