KEGG   Mus musculus (house mouse): 20286
Entry
20286             CDS       T01002                                 
Symbol
Zc3h7b, Gm627, Scrg3, Zc2h7b, mKIAA1031
Name
(RefSeq) zinc finger CCCH type containing 7B
  KO
K24945  zinc finger CCCH domain-containing protein 7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20286 (Zc3h7b)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  Other zinc finger domain-containing proteins
   20286 (Zc3h7b)
SSDB
Motif
Pfam: zf-CCCH TPR_1 TPR_12 TPR_8 ANAPC3 TPR_2 zf-C2H2_2 zf-CCCH_4 zf-C2H2_jaz TPR_19 DUF3856
Other DBs
NCBI-GeneID: 20286
NCBI-ProteinID: NP_001074485
MGI: 1328310
Ensembl: ENSMUSG00000022390
UniProt: F8VPP8
Position
15:81629299..81680470
AA seq 982 aa
MERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYM
EGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDGESIRALF
RKARALNELGRHKEAYECSSRCSLALPHDENVTQLGQELAQKLGLRVRKAYKRPQELETF
SLLSNGAPAGLTDQGTSNGLGSIDDIETDCYVDLRGSPALLPSTPTMPLFPHVLDLLAPL
DGSSRTLPGTEGLDDFSDGDVFGPELDTLLDSLSLVQGGLPGSGMPSELPQLIPVFPGGT
PLLPPVVGGSIPVSSPLPPASFGLVMDPSRKLAASVLDALDSPGPTLDPLDLLPYSEARL
GALDSFGSARGSLDKPDSFLEETSSQDHRPPSSTQKPAPSPEPSMPNTTLLIKNPLAATH
EFKQACQLCYPKTGPRAGDYTYREGLEHKCRRDVLLGRLRSSENQIWKRIRPRPTKTSFV
GSYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKRGSLTI
AKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTS
LKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHEDIVQE
SKKYWQQMEAHAGKASSGLGAPRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAK
ARHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDLCIHAQNGRKCQYVGNCSFAH
SPEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIM
MGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAYRFPMGEFRLCDRLQKGK
ACPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGDT
TGATPDAPVAATATAATTTTGE
NT seq 2949 nt   +upstreamnt  +downstreamnt
atggagaggcagaaacggaaggcggacatcgagaaggggctgcagttcatccagtcaaca
ctacccctgaagcaagaggagtatgaggctttcctgctcaagcttgtgcagaacctgttt
gccgagggcaacgacctgttccgggagaaggactacaagcaggctctggtgcagtacatg
gaagggctgaacgtggctgactacgccgcctctgaccaggtggctctaccccgggagctg
ctgtgcaaactgcatgtcaacagggcagcctgctacttcaccatgggcctgtatgagaag
gcgctggaggacagtgagaaggctttgggcctggatggcgagagtatccgggcactgttc
cgcaaggcgcgcgccctcaacgagctggggcgccacaaagaggcctatgaatgcagcagc
cggtgctccctcgcgcttccccacgatgaaaatgtcacccagctgggccaggagctggct
cagaagcttggactgcgggtacggaaagcctataagagaccccaggaattggaaacgttt
tctctgcttagtaatggcgctccagctggcttaacagatcagggaacttctaacggattg
ggatctatagatgacatcgaaacagactgctacgtggatctccgaggctccccagccctg
ctcccctccactcccacgatgcccctgttccctcatgttctggacctcctggccccactg
gatggcagcagcaggacactccccggcaccgagggcctagatgacttctcagatggggat
gtgtttggtccagaactggacaccctcctggactctctgtctctggtccagggtggcctg
cctggcagtggtatgcctagtgagctgcctcagctgatccccgtgtttcctggtgggacc
ccactcttgccacctgtggtgggtggctccatccccgtgtccagcccactgcctcctgcc
tcctttggccttgtcatggacccctccaggaagctggctgcttctgtgctggatgccctt
gactctccagggcccacgctggaccccctggatctgttaccatactctgaggctcggctg
ggtgcccttgacagctttgggtcagcccgaggctccctggacaagccggactccttccta
gaagagaccagctcgcaggaccaccgacccccaagcagtactcagaagccagccccctcg
ccggagccctcaatgcccaacaccaccctgctcatcaagaaccctctggctgccacccac
gagttcaagcaggcctgccagttgtgctaccccaaaacaggccccagggctggcgactat
acctaccgtgagggcctcgagcacaagtgcagaagggacgtcctcctcggccgcctccgg
agttccgagaaccagatctggaagcgcatccggccgcggcccaccaaaaccagctttgtg
ggctcctactacctgtgcaaagacatgattaacaagcaagactgtaagtacggggataac
tgcaccttcgcctaccatcaggaggagatcgatgtgtggacagaggagcggaagggcaca
ctcaaccgggacctgctctttgaccctctagggggtgtcaagcgtggcagcctcaccatt
gccaagctcctgaaggagcaccagggcatcttcaccttcctctgtgagatctgcttcgac
agcaagccccggatcatcagcaaagggaccaaggactctccatctgtctgctccaacctg
gctgccaagcacagcttttacaacaacaagtgcctggtgcacatcgtccgctccacctct
ctcaagtactccaagatccgtcagttccaggagcacttccagtttgacgtgtgccgccac
gaggtgcgctatggttgcctgcgcgaggacagctgccacttcgcccatagtttcattgag
ctcaaggtctggttgctgcagcagtactcaggaatgacccatgaagacatcgttcaggaa
tccaagaaatactggcaacagatggaagcccacgcagggaaggccagcagcggcttgggt
gccccaaggacacacggacccagcacttttgacctgcagatgaagtttgtgtgcggtcag
tgttggaggaatgggcaggtggtagagccggacaaggacctcaagtactgcagtgccaag
gcccggcattgctggaccaaggagaggcgggtccttctggtgatgtccaaggccaagagg
aaatgggtgtccgtgaggccgctgccatccattcgaaacttcccacagcaatatgaccta
tgtattcatgcccagaacggccgcaaatgccagtatgtggggaactgctccttcgcacac
agccctgaggagagggacatgtggaccttcatgaaggagaacaagatcctggatatgcaa
cagacctatgacatgtggctgaagaaacacaacccagggaagccgggagaagggaccccc
atcagctctcgggaaggagagaagcagatccagatgcccacagactatgctgacatcatg
atgggctaccactgctggctctgcggcaagaacagcaacagcaagaaacagtggcagcag
cacattcagtctgagaagcacaaggagaaggtcttcacttctgacagcgacgccagcggc
tgggcctaccgcttccccatgggcgagttccgactctgtgacaggctccagaagggcaag
gcctgcccagacggagacaagtgccgttgtgcccatggacaagaggaactcaacgagtgg
ctggaccggcgtgaggtgctgaagcaaaagcttgccaaggcccgcaaggacatgcttctg
tgtccacgggatgatgacttcggcaaatacaacttcctgctgcaagaggacggggacacc
actggtgccaccccagatgcccctgttgctgcaactgctactgctgccaccaccaccact
ggggagtag

DBGET integrated database retrieval system