KEGG   Mus musculus (mouse): 20293
Entry
20293             CDS       T01002                                 

Gene name
Ccl12, MCP-, MCP-5, Scya, Scya12
Definition
(RefSeq) chemokine (C-C motif) ligand 12
  KO
K14624  C-C motif chemokine 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05144  Malaria
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    20293 (Ccl12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20293 (Ccl12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20293 (Ccl12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    20293 (Ccl12)
   04657 IL-17 signaling pathway
    20293 (Ccl12)
   04062 Chemokine signaling pathway
    20293 (Ccl12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    20293 (Ccl12)
   05164 Influenza A
    20293 (Ccl12)
   05168 Herpes simplex virus 1 infection
    20293 (Ccl12)
   05163 Human cytomegalovirus infection
    20293 (Ccl12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    20293 (Ccl12)
  09174 Infectious disease: parasitic
   05144 Malaria
    20293 (Ccl12)
   05142 Chagas disease
    20293 (Ccl12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    20293 (Ccl12)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    20293 (Ccl12)
   05418 Fluid shear stress and atherosclerosis
    20293 (Ccl12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    20293 (Ccl12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20293 (Ccl12)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20293 (Ccl12)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20293 (Ccl12)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Chemokines
   20293 (Ccl12)
SSDB
Motif
Pfam: IL8 Amastin
Other DBs
NCBI-GeneID: 20293
NCBI-ProteinID: NP_035461
MGI: 108224
Ensembl: ENSMUSG00000035352
Vega: OTTMUSG00000000861
UniProt: Q62401 Q545B5
Position
11 C; 11 49.9 cM
AA seq 104 aa
MKISTLLCLLLIATTISPQVLAGPDAVSTPVTCCYNVVKQKIHVRKLKSYRRITSSQCPR
EAVIFRTILDKEICADPKEKWVKNSINHLDKTSQTFILEPSCLG
NT seq 315 nt   +upstreamnt  +downstreamnt
atgaagatttccacacttctatgcctcctgctcatagctaccaccatcagtcctcaggta
ttggctggaccagatgcggtgagcaccccagtcacgtgctgttataatgttgttaagcag
aagattcacgtccggaagctgaagagctacaggagaatcacaagcagccagtgtccccgg
gaagctgtgatcttcaggaccatactggataaggagatctgtgctgaccccaaggagaag
tgggttaagaattccataaaccacttggataagacgtctcaaaccttcatccttgaacct
tcatgtctaggctga

KEGG   Mus musculus (mouse): 20296
Entry
20296             CDS       T01002                                 

Gene name
Ccl2, AI323594, HC11, JE, MCA, MCAF, MCP, MCP-, MCP-1, MCP1, SMC-C, SMC-CF, Scy, Scya2, Sig, Sigje
Definition
(RefSeq) chemokine (C-C motif) ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05144  Malaria
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    20296 (Ccl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20296 (Ccl2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20296 (Ccl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    20296 (Ccl2)
   04657 IL-17 signaling pathway
    20296 (Ccl2)
   04062 Chemokine signaling pathway
    20296 (Ccl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    20296 (Ccl2)
   05164 Influenza A
    20296 (Ccl2)
   05168 Herpes simplex virus 1 infection
    20296 (Ccl2)
   05163 Human cytomegalovirus infection
    20296 (Ccl2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    20296 (Ccl2)
  09174 Infectious disease: parasitic
   05144 Malaria
    20296 (Ccl2)
   05142 Chagas disease
    20296 (Ccl2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    20296 (Ccl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    20296 (Ccl2)
   05418 Fluid shear stress and atherosclerosis
    20296 (Ccl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    20296 (Ccl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20296 (Ccl2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20296 (Ccl2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20296 (Ccl2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Chemokines
   20296 (Ccl2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 20296
NCBI-ProteinID: NP_035463
MGI: 98259
Ensembl: ENSMUSG00000035385
Vega: OTTMUSG00000000852
UniProt: P10148 Q5SVU3
Position
11 B5; 11 49.82 cM
AA seq 148 aa
MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCP
KEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLT
RKSEANASTTFSTTTSSTSVGVTSVTVN
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcaggtccctgtcatgcttctgggcctgctgttcacagttgccggctggagcatccac
gtgttggctcagccagatgcagttaacgccccactcacctgctgctactcattcaccagc
aagatgatcccaatgagtaggctggagagctacaagaggatcaccagcagcaggtgtccc
aaagaagctgtagtttttgtcaccaagctcaagagagaggtctgtgctgaccccaagaag
gaatgggtccagacatacattaaaaacctggatcggaaccaaatgagatcagaacctaca
actttatttaaaactgcatctgccctaaggtcttcagcacctttgaatgtgaagttgacc
cgtaaatctgaagctaatgcatccactaccttttccacaaccacctcaagcacttctgta
ggagtgaccagtgtgacagtgaactag

DBGET integrated database retrieval system