KEGG   Mus musculus (mouse): 20295
Entry
20295             CDS       T01002                                 

Gene name
Ccl17, ABCD-, Abcd-2, Scya, Scya17, Scya17l, TA, Tarc
Definition
(RefSeq) chemokine (C-C motif) ligand 17
  KO
K21083  C-C motif chemokine 17
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20295 (Ccl17)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20295 (Ccl17)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    20295 (Ccl17)
   04657 IL-17 signaling pathway
    20295 (Ccl17)
   04062 Chemokine signaling pathway
    20295 (Ccl17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20295 (Ccl17)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20295 (Ccl17)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 20295
NCBI-ProteinID: NP_035462
MGI: 1329039
Ensembl: ENSMUSG00000031780
Vega: OTTMUSG00000061705
UniProt: Q9WUZ6 F6R5P4
Position
8 C5; 8 46.85 cM
AA seq 103 aa
MKTFTSAFGTMRSLQMLLLAALLLGTFLQHARAARATNVGRECCLDYFKGAIPIRKLVSW
YKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaagaccttcacctcagcttttggtaccatgaggtcacttcagatgctgctcctggct
gctctgcttctggggacttttctgcagcatgccagagctgctcgagccaccaatgtaggc
cgagagtgctgcctggattacttcaaaggggccattcctatcaggaagttggtgagctgg
tataagacctcagtggagtgttccagggatgccatcgtgtttctgactgtccagggcaag
ctcatctgtgcagaccccaaagacaaacatgtgaagaaggccatcagattggtgaaaaac
ccaaggccatga

DBGET integrated database retrieval system