KEGG   Mus musculus (mouse): 20297Help
Entry
20297             CDS       T01002                                 

Gene name
Ccl20, CKb4, LARC, MIP-3A, MIP-3[a], MIP3A, ST38, Scya20, exodus-1
Definition
(RefSeq) chemokine (C-C motif) ligand 20
  KO
K14625  C-C motif chemokine 20
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04062  Chemokine signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    20297 (Ccl20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20297 (Ccl20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    20297 (Ccl20)
   04062 Chemokine signaling pathway
    20297 (Ccl20)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    20297 (Ccl20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20297 (Ccl20)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20297 (Ccl20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 20297
NCBI-ProteinID: NP_058656
MGI: 1329031
Ensembl: ENSMUSG00000026166
Vega: OTTMUSG00000016631
UniProt: O89093 Q54AI7 Q642U4
Structure
PDB: 

Position
1 C5; 1 42.69 cM
AA seq 97 aa AA seqDB search
MACGGKRLLFLALAWVLLAHLCSQAEAASNYDCCLSYIQTPLPSRAIVGFTRQMADEACD
INAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcggtggcaagcgtctgctcttccttgctttggcatgggtactgctggctcac
ctctgcagccaggcagaagcagcaagcaactacgactgttgcctctcgtacatacagacg
cctcttccttccagagctattgtgggtttcacaagacagatggccgatgaagcttgtgac
attaatgctatcatctttcacacgaagaaaagaaaatctgtgtgcgctgatccaaagcag
aactgggtgaaaagggctgtgaacctcctcagcctaagagtcaagaagatgtaa

DBGET integrated database retrieval system