KEGG   Mus musculus (mouse): 20300
Entry
20300             CDS       T01002                                 

Gene name
Ccl25, A130072A22Rik, AI852536, CKb15, Scya, Scya25, TECK
Definition
(RefSeq) chemokine (C-C motif) ligand 25
  KO
K13072  C-C motif chemokine 25
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20300 (Ccl25)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20300 (Ccl25)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    20300 (Ccl25)
   04062 Chemokine signaling pathway
    20300 (Ccl25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20300 (Ccl25)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20300 (Ccl25)
SSDB
Motif
Pfam: IL8 PIP49_N
Other DBs
NCBI-GeneID: 20300
NCBI-ProteinID: NP_033164
MGI: 1099448
Ensembl: ENSMUSG00000023235
Vega: OTTMUSG00000022436
UniProt: O35903 Q3V2F3
Position
8 A1.1; 8 2.01 cM
AA seq 144 aa
MKLWLFACLVACFVGAWMPVVHAQGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNL
RAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENP
NSTSVRSATLGHPRMVMMPRKTNN
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaaactgtggctttttgcctgcctggttgcctgttttgttggggcctggatgccggtt
gtccatgcccaaggtgcctttgaagactgctgcctgggttaccagcacaggatcaaatgg
aatgttctccggcatgctaggaattatcaccagcaggaagtgagtggaagctgcaaccta
cgtgctgtgagattctacttccgccagaaagtagtgtgtgggaatccagaggacatgaat
gtgaagagggcgatgagaatcttgacagctaggaaaaggctagtccactggaagagcgcc
tcagactctcagactgaaaggaagaagtcaaaccatatgaagtccaaggtggagaacccc
aacagtacaagcgtgaggagtgccaccctaggtcatcccaggatggtgatgatgcccaga
aagaccaacaattaa

DBGET integrated database retrieval system