KEGG   Mus musculus (mouse): 20302
Entry
20302             CDS       T01002                                 

Gene name
Ccl3, AI323804, CCL, G0S19-, G0S19-1, LD78, LD78alpha, MIP-, MIP-1alpha, MIP1, MIP1-, MIP1-(a), MIP1-alpha, Mi, Mip1a, Scy, Scya3
Definition
(RefSeq) chemokine (C-C motif) ligand 3
  KO
K05408  C-C motif chemokine 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu05142  Chagas disease
mmu05163  Human cytomegalovirus infection
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20302 (Ccl3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20302 (Ccl3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    20302 (Ccl3)
   04062 Chemokine signaling pathway
    20302 (Ccl3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    20302 (Ccl3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    20302 (Ccl3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    20302 (Ccl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20302 (Ccl3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20302 (Ccl3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20302 (Ccl3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Chemokines
   20302 (Ccl3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 20302
NCBI-ProteinID: NP_035467
MGI: 98260
Ensembl: ENSMUSG00000000982
Vega: OTTMUSG00000000991
UniProt: P10855 Q5QNW0
Structure
PDB: 
4ZLT

Position
11 C; 11 51.04 cM
AA seq 92 aa
MKVSTTALAVLLCTMTLCNQVFSAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQP
GVIFLTKRNRQICADSKETWVQEYITDLELNA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaggtctccaccactgcccttgctgttcttctctgtaccatgacactctgcaaccaa
gtcttctcagcgccatatggagctgacaccccgactgcctgctgcttctcctacagccgg
aagattccacgccaattcatcgttgactattttgaaaccagcagcctttgctcccagcca
ggtgtcattttcctgactaagagaaaccggcagatctgcgctgactccaaagagacctgg
gtccaagaatacatcactgacctggaactgaatgcctga

DBGET integrated database retrieval system