KEGG   Mus musculus (mouse): 20304Help
Entry
20304             CDS       T01002                                 

Gene name
Ccl5, MuRantes, RANTES, SISd, Scya5, TCP228
Definition
(RefSeq) chemokine (C-C motif) ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04062  Chemokine signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04668  TNF signaling pathway
mmu05020  Prion diseases
mmu05142  Chagas disease (American trypanosomiasis)
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05168  Herpes simplex infection
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    20304 (Ccl5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20304 (Ccl5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    20304 (Ccl5)
   04621 NOD-like receptor signaling pathway
    20304 (Ccl5)
   04623 Cytosolic DNA-sensing pathway
    20304 (Ccl5)
   04062 Chemokine signaling pathway
    20304 (Ccl5)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    20304 (Ccl5)
  09164 Neurodegenerative diseases
   05020 Prion diseases
    20304 (Ccl5)
  09172 Infectious diseases: Viral
   05164 Influenza A
    20304 (Ccl5)
   05168 Herpes simplex infection
    20304 (Ccl5)
   05163 Human cytomegalovirus infection
    20304 (Ccl5)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    20304 (Ccl5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20304 (Ccl5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20304 (Ccl5)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20304 (Ccl5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Chemokines
   20304 (Ccl5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 20304
NCBI-ProteinID: NP_038681
MGI: 98262
Ensembl: ENSMUSG00000035042
Vega: OTTMUSG00000000992
UniProt: P30882 Q5XZF2
Structure
PDB: 

Position
11 C; 11 50.66 cM
AA seq 91 aa AA seqDB search
MKISAAALTIILTAAALCTPAPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNL
AVVFVTRRNRQVCANPEKKWVQEYINYLEMS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctctgcagctgccctcaccatcatcctcactgcagccgccctctgcaccccc
gcacctgcctcaccatatggctcggacaccactccctgctgctttgcctacctctccctc
gcgctgcctcgtgcccacgtcaaggagtatttctacaccagcagcaagtgctccaatctt
gcagtcgtgtttgtcactcgaaggaaccgccaagtgtgtgccaacccagagaagaagtgg
gttcaagaatacatcaactatttggagatgagctag

DBGET integrated database retrieval system