KEGG   Mus musculus (mouse): 20304
Entry
20304             CDS       T01002                                 

Gene name
Ccl5, MuRa, MuRantes, RA, RANTES, S, SISd, Scy, Scya5, TCP22, TCP228
Definition
(RefSeq) chemokine (C-C motif) ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04668  TNF signaling pathway
mmu05020  Prion disease
mmu05142  Chagas disease
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    20304 (Ccl5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20304 (Ccl5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20304 (Ccl5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    20304 (Ccl5)
   04621 NOD-like receptor signaling pathway
    20304 (Ccl5)
   04623 Cytosolic DNA-sensing pathway
    20304 (Ccl5)
   04062 Chemokine signaling pathway
    20304 (Ccl5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    20304 (Ccl5)
   05168 Herpes simplex virus 1 infection
    20304 (Ccl5)
   05163 Human cytomegalovirus infection
    20304 (Ccl5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    20304 (Ccl5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    20304 (Ccl5)
  09164 Neurodegenerative disease
   05020 Prion disease
    20304 (Ccl5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20304 (Ccl5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20304 (Ccl5)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20304 (Ccl5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Chemokines
   20304 (Ccl5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 20304
NCBI-ProteinID: NP_038681
MGI: 98262
Ensembl: ENSMUSG00000035042
Vega: OTTMUSG00000000992
UniProt: P30882 Q5XZF2
Structure
PDB: 
5YAM

Position
11 C; 11 50.66 cM
AA seq 91 aa
MKISAAALTIILTAAALCTPAPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNL
AVVFVTRRNRQVCANPEKKWVQEYINYLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaagatctctgcagctgccctcaccatcatcctcactgcagccgccctctgcaccccc
gcacctgcctcaccatatggctcggacaccactccctgctgctttgcctacctctccctc
gcgctgcctcgtgcccacgtcaaggagtatttctacaccagcagcaagtgctccaatctt
gcagtcgtgtttgtcactcgaaggaaccgccaagtgtgtgccaacccagagaagaagtgg
gttcaagaatacatcaactatttggagatgagctag

DBGET integrated database retrieval system