KEGG   Mus musculus (mouse): 20310Help
Entry
20310             CDS       T01002                                 

Gene name
Cxcl2, CINC-2a, GROb, Gro2, MIP-2, MIP-2a, Mgsa-b, Mip2, Scyb, Scyb2
Definition
(RefSeq) chemokine (C-X-C motif) ligand 2
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05132  Salmonella infection
mmu05134  Legionellosis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    20310 (Cxcl2)
   04668 TNF signaling pathway
    20310 (Cxcl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20310 (Cxcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    20310 (Cxcl2)
   04657 IL-17 signaling pathway
    20310 (Cxcl2)
   04062 Chemokine signaling pathway
    20310 (Cxcl2)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    20310 (Cxcl2)
   05134 Legionellosis
    20310 (Cxcl2)
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    20310 (Cxcl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20310 (Cxcl2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20310 (Cxcl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 20310
NCBI-ProteinID: NP_033166
MGI: 1340094
Ensembl: ENSMUSG00000058427
Vega: OTTMUSG00000055510
UniProt: P10889 Q3U1J5
Structure
PDB: 

Position
5 E1; 5 44.78 cM
AA seq 100 aa AA seqDB search
MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGP
HCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggcccctcccacctgccggctcctcagtgctgcactggtcctgctgctgctgctggcc
accaaccaccaggctacaggggctgttgtggccagtgaactgcgctgtcaatgcctgaag
accctgccaagggttgacttcaagaacatccagagcttgagtgtgacgcccccaggaccc
cactgcgcccagacagaagtcatagccactctcaagggcggtcaaaaagtttgccttgac
cctgaagcccccctggttcagaaaatcatccaaaagatactgaacaaaggcaaggctaac
tga

DBGET integrated database retrieval system