KEGG   Mus musculus (mouse): 20311
Entry
20311             CDS       T01002                                 

Gene name
Cxcl5, AMCF-II, Cxcl6, ENA-78, GCP-2, LIX, Scyb5, Scyb6
Definition
(RefSeq) chemokine (C-X-C motif) ligand 5
  KO
K05506  C-X-C motif chemokine 5/6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05133  Pertussis
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    20311 (Cxcl5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20311 (Cxcl5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20311 (Cxcl5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    20311 (Cxcl5)
   04062 Chemokine signaling pathway
    20311 (Cxcl5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    20311 (Cxcl5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    20311 (Cxcl5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20311 (Cxcl5)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20311 (Cxcl5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 20311
NCBI-ProteinID: NP_033167
MGI: 1096868
Ensembl: ENSMUSG00000029371
Vega: OTTMUSG00000055503
UniProt: P50228
Position
5 E1; 5 44.78 cM
AA seq 132 aa
MSLQLRSSARIPSGSISPFMRMAPLAFLLLFTLPQHLAEAAPSSVIAATELRCVCLTVTP
KINPKLIANLEVIPAGPQCPTVEVIAKLKNQKEVCLDPEAPVIKKIIQKILGSDKKKAKR
NALAVERTASVQ
NT seq 399 nt   +upstreamnt  +downstreamnt
atgagcctccagctccgcagctccgcccgcatccccagcggttccatctcgccattcatg
cggatggcgccgctggcatttctgttgctgttcacgctgccgcagcatctagctgaagct
gccccttcctcagtcatagccgcaacggagctgcgttgtgtttgcttaaccgtaactcca
aaaattaatcccaaattgatcgctaatttggaggtgatccctgcaggtccacagtgccct
acggtggaagtcatagctaaactgaaaaaccagaaggaggtctgtctggatccagaagct
cctgtgataaagaaaatcattcagaaaatattgggcagtgacaaaaagaaagctaagcgg
aatgcactcgcagtggaaagaacggccagtgttcaatag

DBGET integrated database retrieval system