KEGG   Mus musculus (mouse): 20317
Entry
20317             CDS       T01002                                 

Symbol
Serpinf1, AI195227, EPC-1, Pedf, Pedfl, Sdf3
Name
(RefSeq) serine (or cysteine) peptidase inhibitor, clade F, member 1
  KO
K19614  pigment epithelium-derived factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    20317 (Serpinf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    20317 (Serpinf1)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   20317 (Serpinf1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 20317
NCBI-ProteinID: NP_035470
MGI: 108080
Ensembl: ENSMUSG00000000753
Vega: OTTMUSG00000006203
UniProt: P97298
Position
11; 11 B5
AA seq 417 aa
MQALVLLLWTGALLGHGSSQNVPSSSEGSPVPDSTGEPVEEEDPFFKVPVNKLAAAVSNF
GYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPDIHST
YKELLASVTAPEKNLKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRVDLQEIN
NWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDRTVRV
PMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLTMIEESLTSEFIHDI
DRELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFESPDFSKITGKPVKLTQVEHRAA
FEWNEEGAGSSPSPGLQPVRLTFPLDYHLNQPFLFVLRDTDTGALLFIGRILDPSST
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgcaggccctggtgctactcctctggactggagccctgctcgggcacggcagcagccag
aacgtccccagcagctctgagggctccccagtcccggacagcacgggcgagcccgtggag
gaggaggaccccttcttcaaggtccctgtgaacaagctggcagcagctgtctccaacttc
ggctacgatctgtaccgcctgagatccagtgccagcccaacgggcaacgtcctgctgtct
ccactcagcgtggccacggccctctctgccctttctctgggagctgaacatcgaacagag
tctgtcattcaccgggctctctactacgacctgatcaccaaccctgacatccacagcacc
tacaaggagctccttgcctctgttactgcccctgagaagaacctcaagagtgcttccaga
attgtgtttgagaggaaacttcgagtcaaatccagctttgttgcccctctggagaagtcc
tatgggaccaggccccggatcctcacgggcaaccctcgagtagaccttcaggagattaac
aactgggtgcaggcccagatgaaagggaagattgcccggtccacgagggaaatgcccagt
gccctcagcatccttctccttggcgtggcttacttcaaggggcagtgggtaaccaagttt
gactcgagaaagacgaccctccaggattttcatttggacgaggacaggaccgtgagagtc
cccatgatgtcagatcctaaggccatcttacgatacggcttggactctgatctcaactgc
aagattgcccagctgcccttgacaggaagtatgagcatcatcttcttcctgcccctgacc
gtgacccagaacttgaccatgatagaagagagcctcacctctgagttcattcatgacatc
gaccgagaactgaagactatccaagctgtgctgactgtccccaagctgaagctgagcttc
gaaggcgaacttaccaagtctctgcaggacatgaagctacagtcgttgtttgaatcaccc
gacttcagcaagattactggcaaacccgtgaagctcacccaagtggaacacagggctgct
ttcgagtggaatgaagagggggcaggaagcagccccagcccaggcctccagcccgtccgc
ctcaccttcccgctagactatcaccttaaccaacctttcctctttgttctgagggacacg
gacacgggggccctcctcttcataggcagaatcctggaccccagtagtacttaa

DBGET integrated database retrieval system