KEGG   Mus musculus (mouse): 20322Help
Entry
20322             CDS       T01002                                 

Gene name
Sord, SDH, Sdh-1, Sdh1, Sodh-1, XDH
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu00051  Fructose and mannose metabolism
mmu01100  Metabolic pathways
Module
mmu_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    20322 (Sord)
   00051 Fructose and mannose metabolism
    20322 (Sord)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     20322 (Sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 Sacchrp_dh_NADP 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 20322
NCBI-ProteinID: NP_666238
MGI: 98266
Ensembl: ENSMUSG00000027227
Vega: OTTMUSG00000015564
UniProt: Q64442
Position
2 E5; 2 60.59 cM
AA seq 357 aa AA seqDB search
MAAPAKGENLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDF
VVKKPMVLGHEAAGTVTKVGELVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFC
ATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCG
AGPVGMVTLLVAKAMGAAQVVVTDLSASRLTKAKEVGADFTIQVGKETPQEIASKVESLL
GSKPEVTIECTGAESSVQTGIYATHSGGTLVIVGMGAEMVNLPLVHAAIREVDIKGVFRY
CNTWPMAISMLASKTLNVKPLVTHRFPLEKAVEAFETAKKGVGLKVMIKCDPNDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccagctaagggcgagaacctgtccctggtggtgcacggacctggagacatc
cgcctggagaactacccaatacctgagctcggcccaaatgatgtgttactaaagatgcac
tcggtggggatttgcggctcagatgttcactactgggagcatggacgaattggggacttt
gttgtgaaaaagccaatggtgcttgggcatgaggctgctggaacagtcacaaaagtagga
gagttggtgaaacatctgaaaccaggagatcgggttgccatcgagcctggcgttccccga
gaagtagatgagtactgcaagattggccggtacaacctgacgccgactatcttcttctgt
gccacgcccccggatgatggaaacctctgccgattctacaagcacaatgctgacttctgc
tacaagcttcctgacagtgtcacttttgaagaaggggccctgattgaacctctctctgtg
gggatctatgcctgccgtcgaggttcagtttccctggggaacaaggtccttgtgtgtggc
gctgggccagttgggatggtcactttgcttgtggccaaagcaatgggagctgctcaagtt
gtggtgactgacctatccgcttctcggttgaccaaagccaaggaagttggagcagacttt
accatccaggttggcaaagagacccctcaggaaattgccagtaaggtggaaagcctgctg
ggaagcaagccggaggttaccattgagtgcacaggagccgagtcctccgtccagacgggc
atctatgccactcactctggtgggaccttggtgattgtgggaatgggcgccgagatggtc
aatttacccctggtgcacgcagccattcgggaagtggatatcaaaggcgtgtttcgatac
tgcaacacgtggccgatggcaatttccatgcttgcatcgaagacgttgaatgtaaagccc
ttagttacccacagattccccctggagaaggcagttgaagcctttgaaacagccaaaaag
ggagtggggctgaaagttatgatcaagtgtgaccccaatgaccaaaacccctag

DBGET integrated database retrieval system