KEGG   Mus musculus (house mouse): 20333
Entry
20333             CDS       T01002                                 
Symbol
Sec22b, 4930564D15Rik, AA517334, AI480645, C81333, ERS-24, Sec22l1
Name
(RefSeq) SEC22 homolog B, vesicle trafficking protein
  KO
K08517  vesicle transport protein SEC22
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
mmu04145  Phagosome
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    20333 (Sec22b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    20333 (Sec22b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    20333 (Sec22b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20333 (Sec22b)
Membrane trafficking [BR:mmu04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    20333 (Sec22b)
SSDB
Motif
Pfam: Longin Synaptobrevin IMD Sec20
Other DBs
NCBI-GeneID: 20333
NCBI-ProteinID: NP_035472
MGI: 1338759
Ensembl: ENSMUSG00000027879
UniProt: O08547
Structure
Position
3:97808543..97829634
AA seq 215 aa
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMT
FHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQ
KTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtgctgctgacgatgatcgcccgtgtggcggacggccttccgctggccgcctcgatg
caggaggacgagcagtcaggccgggaccttcaacagtatcagagtcaggctaagcaactc
tttcgaaagttgaatgagcagtcccctacccgatgtaccttggaagcaggagccatgact
tttcactacattattgagcagggggtgtgttacttggttttgtgtgaagctgccttccct
aagaagttggcctttgcctacctagaagatttgcactcggaatttgatgaacagcatggg
aagaaggtgcccactgtgtctaggccctattccttcatcgagtttgataccttcattcag
aaaaccaagaaactctacattgatagccgtgctcggagaaatctaggctccattaacact
gaattgcaggatgtgcagaggatcatggtggccaatattgaagaagtcctacagcgggga
gaagcactctcagcattggattcaaaggctaacaatttgtccagtctatctaagaaatac
cgccaggatgcgaagtacctgaacatgcgctccacttacgccaagcttgcagcagtagct
gtgtttttcatcatgctgatagtgtatgtgcggttttggtggctgtga

DBGET integrated database retrieval system