KEGG   Mus musculus (house mouse): 20334
Entry
20334             CDS       T01002                                 
Symbol
Sec23a, Msec23, Sec23r
Name
(RefSeq) SEC23 homolog A, COPII coat complex component
  KO
K14006  protein transport protein SEC23
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    20334 (Sec23a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20334 (Sec23a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    20334 (Sec23a)
SSDB
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical zf-Sec23_Sec24 Gelsolin APP_E2
Other DBs
NCBI-GeneID: 20334
NCBI-ProteinID: NP_033173
MGI: 1349635
Ensembl: ENSMUSG00000020986
UniProt: Q01405 Q8C1E4
Position
12:complement(59005170..59058803)
AA seq 765 aa
MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL
CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISELNQPAELLPQFSSIEYV
VLRGPQMPLIFLYVVDTCIEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLSAKQLQEMLGLSKVPVTQATRGPQVQQPPPSNRFLQPVQKIDMNL
TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM
VVGDELKTPIRSWHDIEKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM
KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDIHGQFKMGFGGTLEIKTSREIKISGAI
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLAIYFEVVNQHNAPIPQGGRGAVQ
FVTQYQHSSGQRRIRVTTIARNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGP
DVLRWLDRQLIRLCQKFGEYHKDDPNSFRFSETFSLYPQFMFHLRRSPFLQVFNNSPDES
SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPVLLDSSSILADRILLMDTFFQILIYH
GETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgacaacctatttggaatttatccaacaaaatgaagaacgagatggggtccggttcagt
tggaatgtttggccatcgagtcgtctggaagctacaagaatggttgtcccagtggcagcc
ctgtttacacctctgaaggagagacccgacctaccacccatccagtacgagcctgtcctg
tgcagtaggaccacttgccgtgcagttttgaatcctttatgccaagtggattatcgagca
aaactctgggcttgcaacttttgttaccaaaggaatcagtttccacctacatatgctggg
atatctgaattgaaccagcctgcagagcttttacctcagttttcaagcattgaatatgta
gttctgcgtggtccccagatgcctttgatatttctctatgtggttgatacttgcatagaa
gatgaggatttgcaggctctgaaggagtccatgcagatgtcgttgagccttttgccacct
acagctttggttggacttattacctttgggagaatggtgcaggttcatgagcttggatgc
gaaggcatctcaaagagctatgtcttcagaggaacaaaggatctgtctgccaaacaactg
caggaaatgctgggactctctaaagtacctgttactcaagccacacgcggtcctcaggta
cagcaaccgcctccttccaatagattcttacagccagtacagaaaatagacatgaatctc
acagatcttctgggagaacttcagcgagacccttggcctgtaccacaaggaaagagaccg
ctgcgttcctcaggagtggcgctttccatagctgtgggactgcttgagtgtactttcccc
aacactggtgctcggatcatgatgttcatcggtggtcctgctacccaggggcctggcatg
gtggtgggagatgagctaaagacacctataagatcctggcacgacattgagaaggacaat
gccaaatatgttaaaaagggaactaagcattttgaagcgttggctaatcgagctgctaca
acggggcatgtcattgatatctacgcctgtgcgttggaccagacaggcctgctggagatg
aagtgctgtcctaaccttactggaggatacatggtaatgggtgactctttcaatacttcc
ttattcaagcaaacttttcaaagagtcttcaccaaagatatacatggccagtttaaaatg
ggctttggtggcacattagaaataaagacttcaagggaaataaagatttcaggagctatt
ggaccctgtgtgtctcttaattcaaaaggaccttgcgtgtctgaaaatgagattggaaca
ggaggcacttgtcagtggaaaatctgtggcctcagccccaccacaaccttagccatatat
tttgaagttgttaatcagcataatgctccaattcctcaaggaggacgaggtgcagtccaa
tttgtgacccagtatcagcactcaagtggccagagacgcatccgagtgaccacaattgct
aggaactgggcagatgctcaaactcaaatccaaaatattgctgcatcttttgaccaggaa
gcagctgccattctcatggccaggctggcaatatacagagcagaaacagaggaagggcca
gacgtgctaagatggttggacagacaactcattcgactgtgtcaaaaatttggagagtat
cacaaagatgatccaaattccttccggttttcagaaacattttctctttatcctcagttt
atgtttcatttaagaagatctcctttcttgcaagtttttaacaatagtcctgatgagagt
tcatactatcgtcaccatttcatgcgtcaggatctgacccagtctctgatcatgattcag
cccattctgtacgcctactccttcagtggcccgccagagccagttcttctagacagcagc
agcattcttgcagatcggattctcctcatggacacgttcttccagattttgatttatcac
ggtgagactatagcacagtggcggaagtcaggataccaggacatgccagaatatgagaat
ttccggcaccttctgcaagccccagtagatgatgcacaagagattcttcactccagattt
ccaatgccgagatacattgacacggagcatggtggcagccaggctcgtttcctcctttcg
aaagtcaacccttcacagactcataataacatgtatgcctgggggcaggagtccggagca
ccaattctcacggatgatgttagcttacaagtgttcatggatcatttgaagaaacttgca
gtgtcgagtgctgcttga

DBGET integrated database retrieval system