KEGG   Mus musculus (mouse): 20334
Entry
20334             CDS       T01002                                 

Gene name
Sec23a, Msec2, Msec23, Sec2, Sec23r
Definition
(RefSeq) SEC23 homolog A, COPII coat complex component
  KO
K14006  protein transport protein SEC23
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    20334 (Sec23a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20334 (Sec23a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    20334 (Sec23a)
SSDB
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical zf-Sec23_Sec24 Gelsolin APP_E2
Other DBs
NCBI-GeneID: 20334
NCBI-ProteinID: NP_033173
MGI: 1349635
Ensembl: ENSMUSG00000020986
Vega: OTTMUSG00000026430
UniProt: Q01405 Q8C1E4
Position
12; 12 C1
AA seq 765 aa
MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL
CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISELNQPAELLPQFSSIEYV
VLRGPQMPLIFLYVVDTCIEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLSAKQLQEMLGLSKVPVTQATRGPQVQQPPPSNRFLQPVQKIDMNL
TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM
VVGDELKTPIRSWHDIEKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM
KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDIHGQFKMGFGGTLEIKTSREIKISGAI
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLAIYFEVVNQHNAPIPQGGRGAVQ
FVTQYQHSSGQRRIRVTTIARNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGP
DVLRWLDRQLIRLCQKFGEYHKDDPNSFRFSETFSLYPQFMFHLRRSPFLQVFNNSPDES
SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPVLLDSSSILADRILLMDTFFQILIYH
GETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgacaacctatttggaatttatccaacaaaatgaagaacgagatggggtccggttcagt
tggaatgtttggccatcgagtcgtctggaagctacaagaatggttgtcccagtggcagcc
ctgtttacacctctgaaggagagacccgacctaccacccatccagtacgagcctgtcctg
tgcagtaggaccacttgccgtgcagttttgaatcctttatgccaagtggattatcgagca
aaactctgggcttgcaacttttgttaccaaaggaatcagtttccacctacatatgctggg
atatctgaattgaaccagcctgcagagcttttacctcagttttcaagcattgaatatgta
gttctgcgtggtccccagatgcctttgatatttctctatgtggttgatacttgcatagaa
gatgaggatttgcaggctctgaaggagtccatgcagatgtcgttgagccttttgccacct
acagctttggttggacttattacctttgggagaatggtgcaggttcatgagcttggatgc
gaaggcatctcaaagagctatgtcttcagaggaacaaaggatctgtctgccaaacaactg
caggaaatgctgggactctctaaagtacctgttactcaagccacacgcggtcctcaggta
cagcaaccgcctccttccaatagattcttacagccagtacagaaaatagacatgaatctc
acagatcttctgggagaacttcagcgagacccttggcctgtaccacaaggaaagagaccg
ctgcgttcctcaggagtggcgctttccatagctgtgggactgcttgagtgtactttcccc
aacactggtgctcggatcatgatgttcatcggtggtcctgctacccaggggcctggcatg
gtggtgggagatgagctaaagacacctataagatcctggcacgacattgagaaggacaat
gccaaatatgttaaaaagggaactaagcattttgaagcgttggctaatcgagctgctaca
acggggcatgtcattgatatctacgcctgtgcgttggaccagacaggcctgctggagatg
aagtgctgtcctaaccttactggaggatacatggtaatgggtgactctttcaatacttcc
ttattcaagcaaacttttcaaagagtcttcaccaaagatatacatggccagtttaaaatg
ggctttggtggcacattagaaataaagacttcaagggaaataaagatttcaggagctatt
ggaccctgtgtgtctcttaattcaaaaggaccttgcgtgtctgaaaatgagattggaaca
ggaggcacttgtcagtggaaaatctgtggcctcagccccaccacaaccttagccatatat
tttgaagttgttaatcagcataatgctccaattcctcaaggaggacgaggtgcagtccaa
tttgtgacccagtatcagcactcaagtggccagagacgcatccgagtgaccacaattgct
aggaactgggcagatgctcaaactcaaatccaaaatattgctgcatcttttgaccaggaa
gcagctgccattctcatggccaggctggcaatatacagagcagaaacagaggaagggcca
gacgtgctaagatggttggacagacaactcattcgactgtgtcaaaaatttggagagtat
cacaaagatgatccaaattccttccggttttcagaaacattttctctttatcctcagttt
atgtttcatttaagaagatctcctttcttgcaagtttttaacaatagtcctgatgagagt
tcatactatcgtcaccatttcatgcgtcaggatctgacccagtctctgatcatgattcag
cccattctgtacgcctactccttcagtggcccgccagagccagttcttctagacagcagc
agcattcttgcagatcggattctcctcatggacacgttcttccagattttgatttatcac
ggtgagactatagcacagtggcggaagtcaggataccaggacatgccagaatatgagaat
ttccggcaccttctgcaagccccagtagatgatgcacaagagattcttcactccagattt
ccaatgccgagatacattgacacggagcatggtggcagccaggctcgtttcctcctttcg
aaagtcaacccttcacagactcataataacatgtatgcctgggggcaggagtccggagca
ccaattctcacggatgatgttagcttacaagtgttcatggatcatttgaagaaacttgca
gtgtcgagtgctgcttga

KEGG   Mus musculus (mouse): 218811
Entry
218811            CDS       T01002                                 

Gene name
Sec24c, 2610204K03Rik, mKIAA0079
Definition
(RefSeq) Sec24 related gene family, member C (S. cerevisiae)
  KO
K14007  protein transport protein SEC24
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    218811 (Sec24c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    218811 (Sec24c)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    218811 (Sec24c)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin
Other DBs
NCBI-GeneID: 218811
NCBI-ProteinID: NP_001161745
MGI: 1919746
Ensembl: ENSMUSG00000039367
UniProt: A0A286YDI8 Q80U83
Position
14; 14 A3
AA seq 1020 aa
MNVNQSAPPVPPYGQNQPIYPGYHQSSYGGQPGPAAPATPYGAYNGPVPGYQQAPPQGVP
RAPPSSGAPPASAAQVPCGQTTYGQFGQGDIQNGPSSTAQMQRVPGSQQFGPPLAPVVSQ
PAVLQPYGPPPTSTQGFGSLPVNQANHVSSPPAPALPPGTQMTGPPVPPPPPMHSPQQPG
YQLQQNGSFGPARGPQPNYESPYPGAPTFGSQPGPPQPLPPKRLDPDAIPSPQLNELPPQ
QKTRHRIDPDAIPSPIQVIEDDRNNRGSEPFVTGVRGQVPPLVTTNFLVKDQGNASPRYI
RCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGESGPLRCNRCKAYMCP
LMTFIEGGRRFQCSFCSCVNDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATVDYCK
NNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDYLPREGGAEESAIRVGFVTYNK
VLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVSESRAVITSLLDQIPEMFADTRE
TETVFAPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQ
PQTGTYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYACFQVENDQER
FLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVTVEFK
HDDRLNEENGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINYMAKF
AYRAVLNSPVKTVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKS
DVLQPGAEVTTDDRAYVRQLVSSMDVAETNVFFYPRLLPLTKSPLDSTAEPPAVRASEER
LSSGDIYLLENGLNLFVWVGASVQQGVVQSLFNVSSFSQITSGLSVLPVLDNPLSKKVRG
LIDSLRAQRMRYMKLIVVKQEDKLEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQLLS
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgaatgtcaaccagtcagctccacctgttccaccatatgggcagaaccagcccatctac
ccagggtatcatcagtcgagttatggtgggcaaccaggacctgcagcccctgctactccc
tatggagcctacaatggcccagtgccaggttatcagcaggcacctcctcaaggtgtgcca
agagccccaccttcctcaggggcacctccagcctctgcagcacaggtcccttgtggtcag
actacatatggccagtttggccaaggtgatatacagaatgggccgagttccacagctcag
atgcaaagggtccctggttctcagcagtttggtcctccattggcccctgtggtcagccag
ccagctgtgcttcagccctatggccctccccccacaagtacacagggctttgggagtctt
ccagtgaaccaggctaaccacgtgtcctcacctcctgctcctgctctgcccccgggcacc
cagatgactgggcccccagtaccaccgccaccacctatgcactcccctcagcagcctggt
tatcagctgcagcaaaatggttcctttggaccagctcgaggccctcaacctaattatgag
agcccataccctggagcacctacctttggcagtcagcctgggcctccccagccattgcct
cctaagcgtctggaccctgatgccatccccagccctcaacttaatgagctgcctcctcag
cagaaaaccaggcacagaatagatcctgatgccattcctagtccaattcaggttattgaa
gatgatagaaacaaccggggttcagagccatttgttactggtgtacggggacaggtgcca
cctttagtcaccaccaatttcctggtgaaagaccaagggaatgcaagtccccgctacatt
cgatgcacatcctataatatcccttgtacttctgacatggctaaacaggctcaggtgcct
ctggccgctgtcattaaaccactggcaaggctgcctccagaggaggcttcaccgtatgtt
gtggatcatggagaatctggccccctgcgctgtaatcgctgcaaagcatacatgtgccct
ctcatgacattcatcgagggagggaggcgcttccagtgctccttctgcagttgtgtcaat
gatgttcccccccagtattttcaacatctggatcataccggcaaacgtgtggatgcttat
gaccgtcctgagctgtctctgggatcttatgaattcttggctactgtagattactgtaag
aacaataaattccctagtcctcctgccttcatctttatgattgatgtctcctacaatgcc
atcagaactggtcttgttcggctcctctgtgaggagctcaagtcactcttagactaccta
cctagggagggtggagcagaagagtcagcaatccgagttggctttgtcacctataataaa
gtgctccacttctacaatgtgaaaagctccttggctcagccacagatgatggttgtatct
gatgtagctgacatgtttgtgccactgctggatggcttcctagtcaatgtcagtgagtct
cgggctgttatcaccagcttattggatcagattccagaaatgtttgcagatacaagagag
acagagacagtgtttgctccagttatccaggccgggatggaagctctgaaggctgctgag
tgtgcaggaaagctgtttctgttccacacatccttgcccattgcagaggccccagggaag
ctgaagaatagagatgataggaagttgatcaacacagacaaggagaagactctgtttcag
cctcagacaggtacctatcagactctggccaaagagtgtgtggcccaaggctgctgtgtg
gacctcttcctcttccctaaccaatatgtcgatgtggccacactctctgttgttccccag
ctcactggaggctctgtctacaaatatgcctgcttccaggtggaaaatgaccaggaacgg
ttcttgagtgacctgcgtcgggatgtacagaaggtggttggctttgatgctgttatgcgg
gttcggacaagtactggtatccgtgctgtagatttctttggcgctttctatatgagcaat
acaacagatgtggagttggctggattggatggagacaagacagtgactgtggaattcaag
catgatgaccggctcaatgaagagaatggagccctactgcagtgtgccctgctttatacc
agctgtgcagggcagcgtcggctccgcatccacaacttggccctaaactgctgcacccag
ctggctgatctgtatcgaaactgtgagactgacacgctcatcaactacatggccaagttt
gcataccgggctgttctgaatagtcctgtgaagactgtccgtgacactctcatcacccag
tgtgcccagatcctggcctgttatagaaagaactgtgccagcccttcttctgcaggacag
ttgattcttcctgagtgcatgaagctcctcccagtttacctgaactgtgtgttgaagagt
gatgttctgcagcctggagctgaggtcactactgatgatcgtgcctatgttcggcagctg
gtttcctccatggatgtggctgagaccaatgtcttcttctaccctcggctcctaccactg
acaaagtctccccttgatagtaccgctgaaccaccagcagttcgagcctctgaagagcgc
ctaagcagtggcgatatatatttgctggaaaatgggctcaacctctttgtctgggtggga
gcaagcgtccaacaaggtgttgtccagagccttttcaacgtgtcctccttcagtcagatc
accagcggcttgagtgttctgccagttctggataatccactgtctaagaaagttcgaggt
ctcatcgatagcttacgggcacagagaatgcggtacatgaagcttatcgtggtcaagcag
gaagacaagctggagatgctgttcaagcacttcctggtggaagacaagagcctaagtgga
ggtgcatcctatgtggactttctctgtcatatgcacaaggagatccggcagctactgagc
taa

KEGG   Mus musculus (mouse): 27054
Entry
27054             CDS       T01002                                 

Gene name
Sec23b
Definition
(RefSeq) SEC23 homolog B, COPII coat complex component
  KO
K14006  protein transport protein SEC23
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    27054 (Sec23b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    27054 (Sec23b)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    27054 (Sec23b)
SSDB
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical Gelsolin zf-Sec23_Sec24 APP_E2
Other DBs
NCBI-GeneID: 27054
NCBI-ProteinID: NP_001239472
MGI: 1350925
Ensembl: ENSMUSG00000027429
Vega: OTTMUSG00000003918
UniProt: Q9D662
Position
2; 2 G1
AA seq 767 aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAILNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEVNQPAELMPQFSTIEYM
IQRGARSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQEMLGLTKSAMPVQQARPAQPQEQPFVSSRFLQPIHKIDM
NLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP
GMVVGDELKTPIRSWHDIEKDNARFMKKATKHYEMLANRTATNGHCIDIYACALDQTGLL
EMKCCPNLTGGHMVMGDSFNTSLFKQTFQRIFSKDFNGDFRMAFGATLDVKTSRELKIAG
AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPSSTLGIYFEVVNQHNAPVPQGGRGA
IQFVTQYQHSSTQKRIRVTTIARNWADAQSQLRHIEAAFDQEAAAVLMARLGVFRAESEE
GPDVLRWLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFL
LSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAS
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggcaacgtatctggaattcattcagcagaatgaagaacgagatggtgtgcgtttcagt
tggaacgtgtggccttctagccgccttgaagccacaagaatggttgtgcccttggcttgt
ctcctcactcctttaaaagaacgcccagacttacctcctgtacagtatgaacctgtgctt
tgcagtaggcctacctgcaaagctattctcaatccactttgtcaagtggattaccgagca
aaactctgggcctgcaatttctgttttcaaagaaatcagttccctccagcatatgcaggc
atatctgaggtgaatcaacctgctgaattgatgccccagttctccacaattgagtacatg
atccagagaggtgctcggtctcctctgatctttctctatgtggttgacacgtgtttggag
gaagatgaccttcaagcactcaaagagtccctgcagatgtctctgagtctccttcctcca
gatgccctggttggtctcatcacttttgggaggatggtgcaggttcatgagctaagctgt
gaaggaatctccaagagctatgtcttccgagggaccaaggatttaactgcaaagcaaata
caggagatgctgggcctgaccaagtcagccatgcctgtgcagcaagccagacctgctcaa
cctcaggagcagccttttgtttccagcagatttctacagcccattcacaagattgacatg
aacctcacagatcttctcggggagctgcagagggacccatggccagtaactcaggggaag
agaccactgcggtccactggtgttgctttgtccattgctgttggcttgttggaggggact
ttcccaaatactggagccaggatcatgctgttcactggcgggcccccgacccaaggacct
ggcatggtggttggagatgagttgaagactcctattcgttcctggcacgacattgagaaa
gataacgcacgattcatgaagaaggcaaccaagcattatgagatgcttgctaatcgaact
gctacaaatggccactgcattgatatttatgcttgtgcccttgaccaaactggacttctg
gagatgaagtgctgtccaaatcttacaggaggccacatggtgatgggagattctttcaac
acttctcttttcaagcagacattccaaagaatttttagtaaagacttcaacggagatttc
agaatggcgtttggtgctacgttggatgtaaagacctctcgggaactgaagattgcagga
gccattggtccatgcgtgtctctgaatgtgaaagggccatgcgtgtcagaaaatgagctt
ggtgttggtggcacaagtcagtggaagatctgtggcctggatccctcatctactcttggc
atctactttgaagttgtcaatcagcacaatgctccagttccccagggaggcagaggtgcc
atccagtttgtcacacagtatcagcattccagcactcagaagcgcatccgagtgaccacc
attgcccgcaattgggcagatgcacagagtcagctgaggcacatagaagcagcatttgac
caggaggccgcagcagtcctgatggcacggcttggagtgttccgcgcagagtcagaggag
gggcctgacgtgcttcggtggctggatcggcaactcatcagactgtgtcagaagtttggg
cagtataacaaagaagaccctacgtctttcagattgtcagactccttttctctgtatcct
cagttcatgttccatctgagaagatctccatttcttcaagtatttaacaacagtcctgat
gagtcctcctattatagacaccattttgcccggcaggatctgactcagtccctcattatg
atccagcccattctctattcttactccttccacggaccaccagagcctgtactcctggac
agcagtagcattctagctgacagaattctgctgatggatactttcttccaaattgtcatt
taccttggtgagaccatagcccagtggcggaaggctggataccaggacatgcccgagtat
gaaaacttcaagcaccttcttcaggcgcccctggatgatgcccaagaaattctgcaagca
cgcttcccaatgccacgttatatcaacacagagcatggcggcagtcaggctcggttcctg
ttgtctaaagttaacccatctcagacacacaataacctgtatgcctgggggcaggaaact
ggagcgcccatcctgacagacgatgtcagcctacaggtgttcatggatcacctgaagaag
ctggctgtgtctagtgcctcttaa

KEGG   Mus musculus (mouse): 69608
Entry
69608             CDS       T01002                                 

Gene name
Sec24d, 2310020L09Rik, Gm1349
Definition
(RefSeq) Sec24 related gene family, member D (S. cerevisiae)
  KO
K14007  protein transport protein SEC24
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    69608 (Sec24d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69608 (Sec24d)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    69608 (Sec24d)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 69608
NCBI-ProteinID: NP_081411
MGI: 1916858
Ensembl: ENSMUSG00000039234
Vega: OTTMUSG00000052539
UniProt: Q6NXL1
Position
3; 3 G1
AA seq 1032 aa
MSQQGYVATPPYSQSQPGMGISPPHYGHYGDPSHASSPPGVMKPLGPSAAPSGMLPPGPL
PPGPPQFGPNGAHTPGHPPQRFPGPPPVNSVAPSYASGQTLPQSSYPGPGSTSSVTQLGS
QFSSMQINSYGVGATPQSQGPPGPQSAGAFQGPPQPAQPSILQPGHQVPPPPPTALNGPG
ASPMSPPTHRQDGLPGPAPLNAQYQPPPPPGQTLGPGYPPQQATNYGPQMGGAQMSYPGG
FPGGPAQMAGPAPQLQRKLDPDSIPSPIQVIENDRATRGGQVYTTNTRGQVPPLVTTECV
IQDQGHSSPRYIRCTTYCFPCTSDMAKQAQIPLAAVIKPFADIPPNETPLYLVNHGESGP
VRCNRCKAYMCPFMQFIEGGRRYQCGFCSCVNEVPPFYFQHLDHIGRRLDHYEKPELSLG
SYEYVATLDYCRKNKPPSPPAFIFMIDVSYSNIKNGLVKLICEELKTALKRLPKEEHEET
SAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYEESQSVIHNLL
DQIPEMFADSNENETVFAPVIQAGMEALKAAECPGKLFIFHSSLPTAEAPGKLKNRDDKK
LVNTDKEKILFQPQTAVYESLAKDCVANSCSVTLFLFPSQFVDVASLGLVPLLTGGTLYK
YNVFQIHSDSQRFLTDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGIFMNNTTDVEMAA
IDCDKAVTVEFKHDDKLSEDVGALIQCAVLYTTISGQRRLRIHNLALNCSTQLADLYKSC
ETDALINFFAKSAFKAVLNQPLKAIREILVNQTAHMLACYRKHCASPSAASQLILPDSMK
VLPVYMNSLLKNCVLLSRSEISPDERAYQRQLVMTMGVADSQLFFYPLLLPIHTLDVKSA
ALPPAVRCSESRLSEEGIFLLANGLNMFLWFGVGSPPELIQGIFNVPSFAHINTDMTSLP
EVGSPHSQQLRMIMNNIQQKKPYSMKLIVVKQREQREMAFRQFLVEDKGLYGGSSYVDFL
CCVHKEICQLLN
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgagccaacaaggctatgtggcgacacccccttattctcagtcccagcctggaatgggt
atctctccccctcactacggacactatggggacccgtcccatgcatcctctccaccaggc
gtgatgaagccattggggccttcagctgctccttcagggatgctgcccccaggtccttta
cctcctggacccccacagtttggccccaatggagcccatactccaggccatcctcctcaa
agatttccaggacccccacctgtcaatagtgtggcaccctcttatgcgtcaggccagacc
ctgccacagtcatcttacccaggccctgggtccacttcctctgtcacccagctgggcagt
cagttcagctccatgcagatcaacagctatggtgtgggcgcgactcctcagagccagggt
ccgcctggcccccagtcagcaggcgccttccaggggcctccacaacctgcacagccatct
attctgcagccaggacatcaggttccgccgccaccccccactgccctgaacggccctggt
gcctctcctatgtctccaccaactcacaggcaagatggccttcctgggccagctcctctg
aacgcccagtatcagcccccacctccaccaggccagaccctgggtcctggctaccctcca
cagcaagcaaccaactatggaccgcagatgggaggtgcacagatgtcttacccaggaggg
ttccctggaggtcctgcccagatggctgggccggcaccacagctccagaggaagctggat
ccggactccatccccagccctattcaagtgatcgagaatgacagggccaccagaggtgga
caagtctatacgaccaataccaggggccaggtacctccactggtcaccaccgagtgtgtg
attcaagaccaaggccactcgagcccccgctatatccgctgcactacgtattgctttccg
tgcacgtccgacatggccaagcaagctcagatcccactggctgccgtcatcaaacccttc
gctgacattccgcccaacgagacccccttgtacttggtaaaccatggggagagtggacca
gtgaggtgcaacaggtgcaaagcctacatgtgcccgttcatgcaattcatcgaaggcgga
cggcgctatcagtgcggattctgcagctgtgtgaatgaagtcccaccattctatttccaa
catctggaccacattggaaggagattggaccactatgagaagccagagctgtcgctggga
tcctatgaatatgttgctacattggattactgcagaaagaataaacctcccagcccacca
gccttcatcttcatgattgatgtctcatatagtaacataaagaatggcctcgtcaagctc
atatgtgaagagctgaagaccgcgctgaagcggctacccaaggaggagcatgaggagacg
tctgcaatccgagttggtttcatcacatacaacaaagttctccacttctttaacgtgaag
agtaatctggcccagcctcagatgatggtggtgacggatgtcggagaggtctttgttcct
ttgttggatgggttccttgtcaactatgaagaatctcaatctgtgatccacaatttattg
gaccagattcctgagatgtttgctgactctaatgaaaacgagacagtctttgccccggtc
atccaggccggcatggaggccctgaaggcagcagagtgcccggggaagctcttcatcttc
cattcctctttgcctactgccgaagcaccggggaagctcaagaacagagacgacaaaaag
ctggtgaacacagacaaagagaagatacttttccagccccaaacagctgtctacgaatct
ctggccaaagactgtgtggccaacagctgctcagtgactctgttcctcttccccagtcag
tttgtggatgtggcttccttgggtctggttcctctgctcacgggaggaactctttacaaa
tacaacgttttccagatacattcagatagccaaaggtttctgaccgacctccggaatgat
attgagaagaaaataggcttcgatgctatcatgagggttcggaccagcacaggtttcagg
gccactgatttctttggtggaatattcatgaacaacaccacagatgtggaaatggcggcc
atcgactgcgataaagccgtgacagtggagttcaagcacgatgacaagctcagtgaagat
gtcggggccctgatccagtgtgctgtgctctacacgaccatcagtggtcagcgaagactc
cggattcacaatctcgccttaaactgcagcacccagctagcggatctgtacaagagctgt
gaaactgatgcccttatcaacttctttgccaagtcagcttttaaagcagttttgaaccag
cccttgaaggccatccgggaaattctagtcaatcagactgcccatatgctggcgtgttac
cggaagcactgtgcgagtccgtctgcagcaagccagcttatactgccagattccatgaag
gtgctgcctgtgtacatgaacagtttgttgaaaaactgtgtgctgctcagcagatcggag
atctcccctgatgagcgggcttaccagcggcagctggtcatgaccatgggcgtggctgac
tcccagctcttcttctatccactgctcctgccaatccacacgttagatgtgaagagtgca
gcgctgccaccagccgtccgctgctccgagtcccgactctctgaagaaggaatattcctg
ctggctaacggtctgaacatgttcttatggtttggagtgggcagcccaccagagctgatt
cagggaatatttaatgtgccatcgtttgcacatatcaacacagatatgacatcgctgcct
gaggtgggaagtccacactctcaacaactcagaatgataatgaataatatccagcaaaag
aagccatactcaatgaagctcatcgtggttaaacagcgagagcagcgggagatggctttc
cgacagttcctggtggaagataaagggctctatggaggatcttcgtacgtggatttcctc
tgctgtgttcacaaggagatctgtcaactgcttaactga

KEGG   Mus musculus (mouse): 77371
Entry
77371             CDS       T01002                                 

Gene name
Sec24a
Definition
(RefSeq) Sec24 related gene family, member A (S. cerevisiae)
  KO
K14007  protein transport protein SEC24
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    77371 (Sec24a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    77371 (Sec24a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    77371 (Sec24a)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin Sen15
Other DBs
NCBI-GeneID: 77371
NCBI-ProteinID: NP_780464
MGI: 1924621
Ensembl: ENSMUSG00000036391
Vega: OTTMUSG00000005603
UniProt: Q3U2P1
Position
11; 11 B1.3
AA seq 1090 aa
MAQPRIPAARGAAASLQAQNGAASASGSPYTNGPVHNTLMSPQVSSSQGYDSQPPGSYPR
PMPAKTLNPFSAQSNYGGSQGSGQTLNSPLVTSGPVLPSLHSGPVPRMPLPTSQNPAATP
MPSGSFLPGANPPPPLNWQYNYPSTGPQTNHFPHVAPPTLPGNPNLTADHQYVSSGDPAL
QTSFKKPGSALPLQNPPLPPTFQPGAPPGPPPAGGPPPSRGPAPQKTPPRAAPPPSFNSA
VNQEGITSNANNGSTAAHNTYDEIEGGGFLATPQLVNQNPKTSRSVGSAYPSLPPGYQNS
APPVAGMPPPSLSYPSGPQAFTQTPLGANHLTASMSGLSLHPEGLRVVNLLQERNMLPST
PLQPPVPNLLEDIQKLNCNPELFRCTLTSVPQTQALLNKAKLPLGLLLHPFKDLVQLPVV
TSSTIVRCRSCRTYINPFVNFLDQRRWKCNLCYRVNDVPEEFMYNPLTRVYGEPHKRPEV
QNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAIETGYLNSVCQSLLDNLDLLPGNTRTK
IGFITFDSTIHFYSLQEGLSQPQMLIVSDIDDVFIPMPENLLVNLNESKELVQDLLKTLP
QMFTKTLETQSALGPALQAAFKLISPTGGRMSVFQTQLPTLGVGALKPREEPNQRSSAKE
IHLTPSTDFYKKLALDCSGQQAAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYHHQH
NPVQVQKLQKELHRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDA
GYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNEVFLGADVQAI
SGLLANMAVDRSVTASLSDARDALVNAVIDSLSAYRSSVLSGQQPGLMVPFSLRLFPLFV
LALLKQKSFQTGTSIRLDERIFAMCQVKSQPLVHLMLTTHPSLYRVDNLSDEGALNINDR
TIPQPPILQLSVEKLSRDGAFLMDAGSLLMLWVGRNCSQNFLSQVLGVQNYASIPQTMTD
LPELDTPESARIAAFISWLREQRPFFPVLYVIREESLMKAAFLQSLVEDRTESALSYYEF
LLHIQQQVNK
NT seq 3273 nt   +upstreamnt  +downstreamnt
atggcccagccccggatccccgctgcccgcggtgccgcagctagcctccaggcccagaac
ggagccgcctcagcctcggggtctccctacaccaacggtcctgtccacaatacactgatg
tctccacaagtgtcatcgagtcaaggctatgattcgcaacctccaggatcctaccctcgt
ccaatgccagcaaagactttgaatccattctctgcacagtcgaactacggtggttctcag
ggatctgggcagactcttaatagtccacttgtgacttccggtccagtactaccttcactt
catagtggtcctgttccccgaatgccactacctacttctcagaacccagctgctacacca
atgccttctggtagctttcttcctggagccaacccacccccacctttgaattggcaatat
aactatccatccacaggaccgcagactaaccattttcctcatgtagctccaccaactcta
cctgggaatccaaatttaacagcggatcatcaatatgtttcttctggagaccctgcactt
caaaccagcttcaaaaagccaggttctgcacttcccttacagaacccacctctgcccccc
acttttcagccaggagctcctcctgggccccctccagctggaggcccacctcccagccgg
ggccccgcgccccagaaaacacctcctcgggctgcacccccaccttcatttaactcagct
gtcaatcaggaaggtattacgtcaaatgccaataatggatctacggcggctcataatact
tatgatgagattgaaggaggtggcttcttggcaacaccacagcttgttaatcagaacccc
aaaacaagccgaagtgtgggctctgcatacccctccctgccaccaggctaccagaacagc
gcaccacctgtggctgggatgccaccaccctccctcagttacccaagtggcccccaggcc
tttactcagactcccttaggtgctaatcatttaactgcaagcatgagtggattaagtctg
catccagagggactaagagttgtcaatcttcttcaagaaaggaacatgcttccttccaca
ccactgcagcctccagtcccaaatctgcttgaagacatccagaaactcaactgtaaccca
gagttgttccgatgcacgctgacgagtgtccctcagactcaggccttactgaataaagcc
aagcttcctctggggctgctgctccaccccttcaaggacctagtgcagttgcccgtggtc
acctccagcacaattgtgagatgccgttcatgcaggacttacattaaccctttcgtcaac
ttccttgatcaaagaaggtggaaatgtaacttatgttatcgagtcaatgatgttcctgaa
gaattcatgtacaaccctttaaccagagtttatggagaacctcacaaaagacctgaagtc
cagaatgctactattgagtttatggctccttcagaatacatgttacgaccaccacaacct
ccagtgtacctctttgtatttgatgtatctcacaacgcaatagaaactggatacttgaat
tcagtttgccagagtttgttagacaatctggatctgcttcctggcaacactaggacaaaa
atcggtttcataacatttgatagcactatccatttctacagtcttcaggaaggtctctcc
cagcctcagatgctaatagtttcagatattgacgatgtttttatccctatgccagagaac
ttactagtaaacttaaatgaaagtaaagagcttgttcaagatttactgaaaacgctgcca
caaatgtttacgaagacgctggagacccagagtgccttgggtcctgcacttcaggctgca
ttcaagctgatatcaccaactggtggtcgaatgtctgtcttccaaacacaactcccaacg
cttggtgtaggagctctgaaaccacgagaggaacccaaccaaaggtcatctgctaaggaa
atacatctgacaccatccactgacttctataagaaattagccttggactgttctgggcag
caagcagctgttgacttattccttctcagtggacagtattctgatttggcttccctaggc
tgcatctctcggtactcagcgggtagtgtgtattactatccctcgtaccatcaccagcac
aacccagtgcaagtacagaaactacagaaggaactacacaggtacctcactcggaagatt
ggatttgaggcagtcatgaggatccggtgcaccaaaggtctttccattcatactttccat
gggaacttcttcgtccgttctacagacttactgtctcttcccaatgtcaacccagatgct
gggtatgcggtccagatgtcagtagaagagagtctcactgacactcagctggtttccttc
cagtcagcactcttatatacatcaagcaaaggtgaaagaagaatccgtgtgcatactttg
tgtttgccggtagtttctaccctgaatgaagtctttcttggagctgatgtgcaagcaatt
tcagggttattagccaatatggctgttgacaggtcggtgactgccagcctgagtgatgcc
cgggatgctctggtgaacgctgtcatcgactctctctcagcttaccgctcttcagtcctg
agtggtcagcagccaggcctcatggttcctttctccttgaggcttttcccactttttgtg
ttggctctcctaaaacagaaatctttccagactgggacaagtatacgtctagatgaacga
atttttgccatgtgtcaagtgaaaagccagccattggttcacctcatgctcacaacacat
cccagtttgtacagagttgacaacctctcagatgagggagctctcaacatcaatgacaga
accatacctcagccccccattcttcagctctcggtggagaagttgagcagagatggagcg
ttcctcatggatgcaggctcattactgatgctttgggttggaagaaattgttcacagaat
tttctcagccaagttctgggagttcaaaactatgcatcaattccacagacaatgacagat
cttccagaacttgatacaccagaatctgccagaatagcagcgttcatctcatggctcaga
gaacagaggccatttttcccagtactctatgtaatcagggaggagagtcttatgaaagca
gccttccttcagagcttggtagaagacagaacagagtctgcactgtcatattatgaattc
ctcctgcacatacagcagcaagtgaacaagtga

KEGG   Mus musculus (mouse): 99683
Entry
99683             CDS       T01002                                 

Gene name
Sec24b, AI605202, SEC2, SEC24
Definition
(RefSeq) Sec24 related gene family, member B (S. cerevisiae)
  KO
K14007  protein transport protein SEC24
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    99683 (Sec24b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    99683 (Sec24b)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    99683 (Sec24b)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin Sen15 HpaB
Other DBs
NCBI-GeneID: 99683
NCBI-ProteinID: NP_997092
MGI: 2139764
Ensembl: ENSMUSG00000001052
Vega: OTTMUSG00000036442
UniProt: Q80ZX0
Position
3; 3 G3
AA seq 1251 aa
MSAPAGSPHPAAGARMPPKLGGAVSGLAPPQQNGPAQSPMQVPSGYGLPHQNYMVPSGHY
SQGPGKMTSLPLDSQCDSYYSRPYTVPTQNSGTPSSANQPGAQQMYGRGPSAPHMGGSMP
GSFQGIPASASHSYSSASQPYSSLGNRYSSPTTYSANASVASQGYPSTCSHYPISTVSNV
VYPNVSYPSLPASEPYGQMFTSQSAPPPARPVKESYSGPSTALTYPSRPPPPPSQHQQQQ
QQQQQQQQQQQSHSGYSSLPWSGPALPPAQDSLIRNQMGSLATANSHPTNNENVQPPKSS
SVVSTVLPGPSSTRMPPAPSHPVGPVPSAPPPPEQMQTKGMQYGDYGNNQASSTATPLSS
ASDDEEEQEEDEEAGVDSSSTTSSASPLPNSYDALEGGSYPDMHSSSASSPVPDHALEPS
PTLAQALSAAPTPPAAQPAKVAKPFGYGYPALQPAYQNAAPPPMPAAHPSGPAYTGYPQH
YPGVNQLSSGLGGLSLQSSPQPESLRPVNLTQEKNILPPTPIWAPVPNLSAELSKLNCSP
DSFRCTLTSIPQTQALLNKAKLPLGLLLHPFRDLTQLPVITSNTIVRCRSCRTYINPFVS
FIDQRRWKCNLCYRVNDVPEEFLYNPLTRSYGEPHKRPEVQNSTVEFIASSDYMLRPPQP
AVYLFVLDVSHNAVEAGYLTVLCQSLLENLDKLPGDSRTRIGFMTFDSTIHFYNLQEGLS
QPQMLIVSDIDDVFLPTPDSLLVNLYESKELIKDLLNALPSMFINTRETHSALGPALQAA
FKLMSPTGGRVSVFQTQLPSLGAGLLQSREDPNQRSSTKVVHHLGPATDFYKKLALDCSG
QQTAVDLFLLSSQYSDLASLACMSKYSAGCIFYYPSFHSTHNPSQAEKLQKDLKRYLTRK
IGFEAVMRIRCTKGLSMHTFHGNFFVRSTDLLSLANINPDAGFAVQLSIEESLTDTALVC
FQTALLYTSSKGERRIRVHTLCLPVVSSLADVYAGVDVQAAVCLLANMAVDRSVSSSLSD
ARDALVNAVVDPLSAYSSAVASVPRSTLTAPSSLKLLPLYVLALLKQKAFRTGTSTRLDD
RVYAMCQMKSQPLVHLMKMIHPNLYRIDRLTDEGAIHVNDRVVPQPPLQKLSAEKLTREG
AFLMDCGSVFYIWVGKGCDSNFIENVLGYPDFASIPQKMTHLPELDTLPSERTRSFVTWL
RDSRPLSPVLHLVKDESPAKTDFFQHLLEDRTEAALSYYEFLIHIQQQVCK
NT seq 3756 nt   +upstreamnt  +downstreamnt
atgtcggcccccgccgggtcccctcacccggccgccggcgcccggatgccgcccaagctc
ggcggagctgtctccggcctggcaccgccgcagcagaacggtccagcacagagtccaatg
caagttccatctgggtatgggctgcctcatcaaaactatatggtcccttcaggacattac
tctcaaggacctgggaaaatgacctccttgccattggatagccagtgtgatagttactac
tctcgtccatatacagtaccaacacaaaattcggggactcccagctcagcaaaccaacca
ggagcacagcagatgtatggcagaggtccttccgctcctcacatggggggctccatgccc
ggatctttccaaggaattccagcatcagcatcccattcctattcgagtgcctcccagccc
tactcctctcttgggaatcgctacagtagtcctaccacgtactctgccaatgcttctgtt
gcttctcagggatatccctctacctgtagtcattatcccatctcaactgtgtctaatgtg
gtgtatcctaatgtttcctatccctcgctgcctgccagtgagccatatgggcagatgttt
acctcacagagtgctcctccacctgccaggccagttaaagagtcatactctggccccagc
acagctcttacctacccctcgagacctccacctccaccttctcagcaccagcagcagcag
cagcagcagcagcagcagcagcagcagcagcagagtcattcaggatatagttctctacca
tggtcaggtccagcccttccaccagcccaagacagcctcatccgaaaccaaatgggatcc
ttggctacagcgaacagccacccaactaataatgaaaatgtccaacctcccaagtcaagc
tccgtagtatccacagttttgccaggaccctcatcaacaagaatgccacctgctccaagt
cacccagttgggcctgtgccctctgctccaccccccccagagcagatgcagactaaaggc
atgcagtatggtgactatggtaataatcaagctagctccacagcgactcccttgtcatca
gcttccgatgatgaggaggagcaggaggaggatgaggaagcaggtgttgacagctcttcc
accaccagcagtgcttcgcccttgcccaacagttacgatgccttggaaggaggcagctac
ccagatatgcattcttcttcagcaagcagccctgttcctgaccatgccctggaacccagt
cccaccctcgcccaggctctgtctgcagcccccactccccctgcagctcagccagccaag
gtggcaaagccttttggctatggctacccagctctgcagcctgcctatcagaacgcagca
ccaccacccatgcccgcagcacatcccagcggcccagcgtacactggatatcctcagcat
tacccaggtgtgaaccagctgtcctcaggtctcggaggactaagcctgcagagttctcca
cagccagaaagcctaagacctgtcaacctcacccaggagaaaaatattttacctccaact
cctatttgggctcctgtacctaacctgagtgcagaactcagcaagttaaactgtagtcca
gactcgtttcgatgtaccttgaccagtatcccccagacacaggctttactgaataaagct
aagcttcctttaggattgctgttgcatcccttcagagacctgacgcaattgccagtgata
acctcaaacaccatcgtgaggtgccggtcctgtcggacgtacatcaacccttttgtgtcc
ttcattgatcagcgaagatggaaatgcaacctgtgttatagagttaatgatgttccagaa
gagtttttgtacaaccccctgactcggtcttacggagagcctcataaacggccagaagtc
cagaattctactgtggagttcatcgcatcctcagactacatgctccggcctcctcagccc
gcggtctacttgtttgttttagatgtgtctcataacgcagtggaagctgggtatttgaca
gttttatgccagtccttattagaaaacttagacaagcttcctggagattcacgaacaaga
ataggattcatgacttttgacagcaccattcacttctacaatctacaagaagggttatcc
cagccgcagatgttgattgtatctgatatagacgatgtttttctgcccacgccggatagt
ctgcttgtgaatctgtatgaaagcaaagagcttataaaagacttactgaatgcattacca
agtatgttcatcaataccagagaaacacacagtgcccttggacctgcacttcaggctgcc
ttcaaactcatgtctcccacgggcggccgcgtgtctgtatttcagacacagttaccttcc
ttgggggcaggacttctgcagtccagagaagatccgaatcagaggtcgagtaccaaggtg
gtgcaccatcttggccctgcaaccgacttttataagaagctcgctttagattgctcaggg
cagcaaactgcagtggatttgttccttctaagttcacagtattctgaccttgcttctctg
gcttgcatgtccaagtactctgcagggtgcatattctactatccatctttccactctacc
cacaatccttcgcaagcagaaaagttacaaaaagacctaaaacggtacctcacgaggaag
attggatttgaagctgttatgagaataagatgcactaaagggctctcaatgcacactttc
cacgggaacttctttgtccgctccaccgacttactgtctcttgccaacatcaatcctgat
gctgggtttgcagtacagttgtcaatcgaagagagcctgacagatactgccttagtgtgc
tttcagacagccctgctgtacacatctagcaaaggcgagcggagaattcgagtgcataca
ctgtgcttgccagtcgtaagttccctcgctgacgtttatgcaggagtggatgtgcaagcc
gctgtctgccttctcgccaacatggctgtggaccgctcagtgtcatcgagcctgtcggat
gccagggatgccctggtgaacgctgtggtggatcccctgtctgcctacagctccgccgtg
gcaagtgtgccccgctccaccctgacagcaccaagctcacttaagctgctcccactctat
gttttggcacttcttaaacagaaagcatttagaacagggacaagcacacgcctggatgac
cgtgtctatgccatgtgccagatgaagtcgcagccgcttgtgcatctcatgaaaatgatt
catcccaacttatacaggatagacaggctgacagacgagggcgccatccacgtgaatgac
agggtagtacctcagccaccgcttcagaagctgtctgcagagaagctgacccgagaaggc
gctttcctcatggactgcggctcagttttctacatttgggttggcaaaggctgtgacagt
aacttcatagagaacgtgcttggataccctgactttgcatcaataccacagaaaatgaca
catcttccagagctagacacacttccatcagaaagaactagatcctttgtgacttggctc
agggacagccgaccgttaagccctgtccttcacttggtaaaagatgagagccctgccaaa
acagactttttccagcatttgcttgaagaccgcacggaagccgcactctcctactatgag
tttctgattcacatccaacagcaggtttgtaagtga

DBGET integrated database retrieval system