KEGG   Mus musculus (mouse): 20336Help
Entry
20336             CDS       T01002                                 

Gene name
Exoc4, C78892, Sec8, Sec8l1
Definition
(RefSeq) exocyst complex component 4
  KO
K06111  exocyst complex component 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20336 (Exoc4)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    20336 (Exoc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec8_exocyst Zw10 Vps54_N PEP-utilisers_N Dor1
Motif
Other DBs
NCBI-GeneID: 20336
NCBI-ProteinID: NP_033174
MGI: 1096376
Ensembl: ENSMUSG00000029763
Vega: OTTMUSG00000014760
UniProt: O35382
Position
6 A3.3; 6 14.59 cM
AA seq 975 aa AA seqDB search
MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDE
LIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIE
HKHVLNLLDEIENIKQVPQKLEQCMASKHYLSATDMLVSAVESLEGPLLQVEGLSDLRLE
LHSKKMNLHLVLIEELHRHLYIKSTSRVVQRNKEKGKMSSHGKDPSPGPLIDVSNIPTPR
KFLDASQYSAAGGSSVREMNLQDVKEDLECDPEENSTLFMGILIQGLARLKKIPETVKAI
KERLEQELKQIVKRSTTQVADSAYQRGESLTVDNQPRLLLELLELLFDKFNAVATAHSVV
LGYLQDSVGTQLTQQEEIKLYDMADVWVKIQDVLQMLLTEYLDMKNTRTASEPSAQLSYA
STGREFAAFFAKKKPQRPKNSLFKFESSSHAISMSAYLREQRRELYSRSGELQGGPDDNL
IEGGGTKFVCKPGARNITVIFHPLLRFIQEIEHALGLGPAKQCPLREFLTVYIKSIFLNQ
VLAEINKEIEGVTKTSDPLKILANADTMKVLGVQRPLLQSTIIVEKTVQDLMNLMHDLSA
YSDQFLNMVCVKLQEYKDTCSTAYRGIVQSEEKLVISASWAKDDDISRLLKSLPNWTNMA
QPKQLRPKREEEEDFIRAAFGKESEVLIGNLGDKLIPPQDILRDVSDLKALANMHESLEW
LAGRTKSAFSNLSTSQMLSPAQESHVNMDLPPVSEQIMQTLSELAKTFQDMADRCLLVLH
LEVRVHCFHYLIPLAKEGNYAIVANVESMDYDPLVVKLNKDISAMEEAMSASLQQHKFQY
IFEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFARQYY
EMLYNTADELLNLVVDQGVKYTELEYIHALTLLHRSQTGVGDQTTQNTRLQRLKEIICEQ
AAIKQATKDKKITTV
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagaagcagctggtgggaaatacaggagcacagtcagcaaaagcaaagacccc
tcggggctgctcatctcggtgatcaggactctgtctaccagtgatgatgttgaagaccga
gaaaatgagaaaggtcgccttgaagaagcctatgagaagtgtgaccgtgacctggatgaa
ttgatcgttcagcactacacagaattgaccacagccattcgcacataccagagtatcaca
gaacgcatcactaactcgaggaataaaatcaagcaggtcaaagagaatctgctttcctgc
aagatgctgctgcattgcaaacgggatgagcttcgtaagctgtggattgaaggaatcgag
cataagcacgtcctgaacctactggatgagattgagaacatcaagcaagtgcctcaaaag
ctggaacagtgcatggccagcaagcactacctcagcgccaccgacatgctggtgtcagca
gtggagtccctggagggtccactgctccaggtggaagggctcagtgatctcaggctggaa
cttcacagcaagaagatgaacctgcacttggttctcatagaggaactgcaccgccatctg
tatatcaaatccactagccgggtggtacagcgtaacaaggaaaaggggaagatgagttct
catggcaaagatccctctcctggtcctctgattgatgtttcaaacatccctactccacgc
aaattccttgatgcttctcaatattctgctgctggaggctcaagtgtgagggagatgaac
ctgcaagacgtcaaggaggacttggagtgtgacccagaggagaacagcactcttttcatg
ggaattcttattcagggcctggccagactgaagaagatccctgagacagttaaagccatt
aaagagcgtctggagcaggagctaaagcagattgtgaagaggtcaaccacccaggtagca
gacagtgcttatcagaggggagagagcctcactgtggacaatcagccaaggttactccta
gaactgctggaactgttgtttgataagtttaatgccgtagccactgcacactcagtggtc
ctggggtacctccaggactctgttgggacccagctaacacagcaggaggagatcaaatta
tatgacatggcagatgtgtgggtgaagatccaggatgtgctgcagatgctgttgactgag
tacttggatatgaagaacacacgcaccgcctcagagccatcagcccaactaagctatgcc
agtactggacgagagttcgcagccttttttgccaagaagaaaccacagaggccaaagaat
tctcttttcaagtttgaatcatcctcccatgctatcagcatgagcgcctatctccgagaa
caaagaagggagctctacagtcggagtggagaactccagggaggtcctgatgacaactta
attgaaggtggaggaacaaaatttgtctgcaaacctggagccagaaatattaccgtcata
ttccatccattactgagatttattcaggagattgaacatgccctgggacttggccctgcc
aaacagtgtcctcttcgagagtttcttaccgtgtatatcaagagcatcttccttaatcag
gtcttggctgagatcaacaaggagattgaaggcgtcaccaaaacctcagaccccttgaag
atcctggctaatgcagacaccatgaaggttctgggagtgcagcggcctcttctacagagc
acaatcatcgtggagaagacagtacaagacctcatgaaccttatgcatgacttgagtgcg
tattcagatcagttcctcaacatggtgtgtgtgaagctccaggagtacaaggacacgtgc
tccacagcctacaggggcattgtccagtcagaagagaaacttgtcatcagtgcttcttgg
gcaaaggatgatgatatcagcagactcttgaaatcgctgccaaactggactaacatggct
cagcccaaacagctaaggcctaagagggaggaggaagaagacttcataagggcagccttt
ggcaaggagtctgaagtcctgattggaaaccttggtgacaaactcattcctccacaagac
attctccgtgacgttagtgacctcaaagccttggccaacatgcacgaaagcctggaatgg
ctggcaggtcgaacaaagtcagctttctccaacctttctacatcccagatgctttcccct
gctcaagagagccacgtgaacatggaccttcccccagtgtctgaacagatcatgcagaca
ctgagtgagcttgccaagaccttccaggacatggctgaccgctgcttgctcgtcctgcat
ctggaagtgagagttcattgtttccactatctcatccctctggcaaaggaggggaactat
gccatcgttgccaatgtggagagtatggattacgaccctctagtggtcaagctcaacaaa
gacatcagtgccatggaagaggccatgagcgccagcctccagcaacataagttccagtac
atctttgaaggtctgggacacctcatctcctgtatcctcattaatggggcccaatacttc
cggcgcatcagtgagtctggcatcaagaaaatgtgtaggaacatttttgttcttcagcag
aacttgaccaacatcaccatgtcacgggaggcagacttggactttgcaaggcagtactac
gagatgctgtacaacacagccgacgagctcctgaacctggtggtggaccagggtgtgaag
tacacagagctagagtacatccatgccctgaccctgctgcaccgaagccagactggtgtg
ggggaccagaccacccagaacaccaggctgcagagactcaaggagatcatctgtgagcag
gctgccatcaagcaagccaccaaggacaagaaaataaccactgtgtga

DBGET integrated database retrieval system