KEGG   Mus musculus (mouse): 20338
Entry
20338             CDS       T01002                                 

Gene name
Sel1l, AW493766, Sel, Sel1h, mKIAA4137
Definition
(RefSeq) sel-1 suppressor of lin-12-like (C. elegans)
  KO
K14026  SEL1 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    20338 (Sel1l)
SSDB
Motif
Pfam: Sel1 fn2
Other DBs
NCBI-GeneID: 20338
NCBI-ProteinID: NP_001034178
MGI: 1329016
Ensembl: ENSMUSG00000020964
Vega: OTTMUSG00000035560
UniProt: Q9Z2G6 Q5DTL8
Structure
PDB: 
5B26

Position
12; 12 D3
AA seq 790 aa
MQVRVRLSLLLLCAVLLGSAAATSDDKTNQDDSLDSKSSLPTDESVKDHTTTGKVVAGQI
FVDSEEAEVESLLQDEEDSSKTQEEEISFLESPNPSSKTYEELKRVRKPVLTAIEGTAHG
EPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKTDEKWGFCETEEDAAKRRQMQEAE
MIYQAGMKILNGSNRKSQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLTQNIQAAKE
MFEKLTEEGSPKGQTGLGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMILGYRYWAG
IGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLIQYY
QFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYSEGS
DIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVD
GQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHTAVE
LFKNVCERGRWSERLMTAYNSYKDEDYNAAVVQYLLLAEQGYEVAQSNAAFILDQREATI
VGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQHSA
QAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQYIREA
NIRDLFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDIPVPRPPGPRPAPPQQ
EGPPEQQPPQ
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgcaggtccgcgtcaggctgtcgttgctgctgctctgcgcggtgctcctgggctcggca
gccgcgacctcggatgacaaaactaaccaggatgactccttagattccaagagttctttg
cccacagatgagtcagtgaaggaccacaccaccacgggcaaagtagttgctggccagata
tttgttgattctgaagaagcagaagtggaatcccttcttcaggacgaggaagatagctcc
aagacccaggaggaagagatcagctttttagaatctccgaatccaagcagcaagacctac
gaagaactaaagagagtgcggaagccagtcttgactgccattgaaggtacggcgcacggg
gagccctgccacttccctttccttttcctggataaggagtatgatgagtgcacctcagac
gggagggaagatggcagactgtggtgtgccacaacctatgactacaagacagatgagaag
tggggcttctgcgaaactgaagaagatgctgccaaaagacgacagatgcaggaagcagag
atgatctatcaggccgggatgaagatactgaatggaagcaataggaagagccaaaagaga
gaagcatatcggtaccttcagaaggcagcaggcatgaatcacaccaaagccctggagaga
gtgtcctatgctctcttgtttggtgattacctcacacagaatatccaggcagccaaagag
atgtttgagaaactgactgaggaagggtctcccaaaggacagactggtcttggctttctc
tacgcttctgggcttggtgttaattcaagtcaggcaaaggctcttgtatattatactttc
ggagctcttggaggcaacctgatagcccatatgattttgggttaccgctactgggctggc
atcggagtcctccagagttgtgagtcggcactgacccattatcgtcttgttgccaatcat
gttgctagtgatatctccctaactggaggctctgtagtccagagaatacggctgcccgat
gaagtggaaaacccggggatgaacagtgggatgctggaagaagacctgattcagtattac
cagttcctagctgagaagggtgacgtccaagcacaggttggcctgggacagctgcatctg
catggagggcgtggagtagaacagaatcaccagagagcgtttgactacttcaacttagca
gcaaatgctggcaattcacatgctatggccttcctgggaaagatgtattctgaaggaagt
gacatcgtacctcagagtaatgagacggcacttcactactttaagaaagctgctgacatg
ggcaaccccgtgggacagagcgggcttggaatggcctacctctacggaagaggcgttcaa
gttaattatgacctggccctcaagtatttccagaaagctgctgagcaaggctgggtggac
gggcagctgcagctcggctctatgtactacaatggcattggagtcaagagagattataag
caggccttgaagtattttaatctggcttctcaaggaggccatatcttggctttctataac
ctcgcacagatgcacgccagcggcacaggggtgatgcggtcctgtcacactgcagtggag
ttgtttaagaatgtgtgtgagcgaggtcgctggtcagagagactgatgactgcctacaac
agctataaggatgaggactacaatgctgcagtggtccagtacctcctgctggctgagcag
ggctacgaggtggcgcagagcaacgcagccttcatcctcgaccagagagaagcaaccatt
gtaggtgagaatgaaacttaccccagagctttactgcattggaacagggccgcctcccaa
ggttacactgtggctagaattaagcttggagactaccacttctatggctttggcactgat
gtggattatgagaccgcatttattcattaccgcctggcttctgagcagcagcacagcgcc
caagctatgtttaacctgggctacatgcacgagaagggcctaggcattaaacaggacatt
caccttgcaaaacgcttttatgacatggcagccgaagctagcccagatgcacaagtacct
gtgttcctcgcactctgcaaattaggtgtcgtctatttcttacagtacatacgggaagca
aacattcgagatctattcacacaactggatatggaccagcttttgggacccgagtgggac
ctttacctcatgaccatcattgcactgctcttgggtacagtcatagcttacaggcagcga
cagcaccaggacataccagttcccaggcccccagggccacggccggctcctccccagcag
gaaggaccaccagagcagcagccaccacagtag

KEGG   Mus musculus (mouse): 228684
Entry
228684            CDS       T01002                                 

Gene name
Sel1l2, Gm118
Definition
(RefSeq) sel-1 suppressor of lin-12-like 2 (C. elegans)
  KO
K14026  SEL1 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    228684 (Sel1l2)
SSDB
Motif
Pfam: Sel1
Other DBs
NCBI-GeneID: 228684
NCBI-ProteinID: NP_001028468
MGI: 2684964
Ensembl: ENSMUSG00000074764
Vega: OTTMUSG00000015603
UniProt: Q3V172
Position
2; 2 F3
AA seq 688 aa
MNPLALLVEILIIIEVTTKNTEAERYNRKQKEVNVTTQVSVSKVKQFLLYLLEQGNANKI
TNKRENPLEKKKHQHKLKIKGIQNKNLLKRNQNYFKNPAKKSITDEGDELFKMGNKILQE
SKSQKQKTEAYTLFTRAANMGNLKAMEKMADAWLFGSFGMQNITAAIQLYESLAKEGSYK
AQNALGFLSSYGIGMEYDQAKALIYYTFGSAGGSMMSQMILGYRYLSGINVLQNCEVALN
HYKKVADYIADKLEKSEGIPVEKVRLTERPENLSSNSEILDWDIYQYYKFLAERGDVQIQ
VSLGQLHLIGRKGLDQDYSKALYYFLKAAKAGSANAMAFIGKMYFEGNAAAPQNNATAFK
YFSMAASKGNAIGLHGLGLLYFHGKGVPVNYGEALKYFQKAAEKGWPNAQFQLGFMYYSG
SGVWKDYKLAFKYFYLASQSGQPLAIYYLAEMYATGTGVLRSCRTAVELYKGVCELGHWA
EKFLTAYFAYKDGDIDSSLIQYALLAEMGYEVAQSNSAFILESKKAKILGKEKLYPMALL
LWNRAAIQGNAFARVKIGDYHYYGYGTKKDYETAATHYSIAADKHHSAQAMFNLAYMYEH
GLGIAKDIHLARRLYDMAAQTSPDAHIPVFFALMKLETMHLLHDILFFNFTMKWKWLKLD
STVGPYWDLLVIGLIVAMLIFLLRNRHR
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgaatcccttggctttgttagtagagatattgatcattatcgaggtcacaaccaaaaat
actgaagcagaaagatataacagaaaacaaaaagaagtgaatgtcaccacacaggtatca
gtgagcaaagtcaagcaatttttattgtatctactggaacaaggaaacgcaaataaaata
accaataaaagagaaaatcccttagaaaaaaagaagcatcaacataagttaaaaataaaa
ggaattcaaaataagaatctcctgaagagaaatcaaaactacttcaaaaacccagccaag
aaaagtatcacagatgaaggagatgagttatttaaaatgggcaacaagattctccaggag
tctaaaagccaaaaacaaaaaacagaagcctacacactcttcaccagagcagccaacatg
ggaaatttgaaagctatggaaaaaatggctgatgcttggctatttggaagtttcggcatg
caaaacataacagcagctattcagttatatgagtccttggctaaagaaggatcatacaaa
gcccaaaatgcattaggatttttatcttcatatggaataggaatggaatatgaccaagcc
aaggcactgatatattatacctttggaagtgctggaggaagcatgatgtcccagatgatt
ctggggtacagatacttgtcaggaattaacgttctgcaaaattgtgaagttgccctaaat
cattacaagaaagtggcagattatattgctgataaattggaaaaaagtgaaggtattccc
gtggaaaaagtgaggctaaccgagagacctgagaatctgagttccaacagtgagattttg
gattgggacatataccaatactataaatttttggcagaaagaggagatgttcagatacaa
gtatctcttggacaattacatctaattgggagaaagggactagatcaagattacagtaag
gcgttatactactttctaaaggcagcaaaagccgggagtgcaaatgccatggcatttata
ggaaagatgtattttgaagggaatgctgctgcaccacaaaataacgccactgccttcaaa
tacttctccatggcggccagcaagggcaacgcaattggccttcatggacttggtctcctt
tacttccatggaaaaggtgttcctgtgaattatggtgaagcacttaaatacttccagaaa
gctgcggagaagggatggcctaatgcacagttccagctgggcttcatgtactactctggc
tctggagtatggaaggattataagcttgccttcaaatacttttacttggcatctcagagt
gggcagcctcttgccatttattatctagccgagatgtacgcaactggcactggagtgctg
agatcatgcagaacggccgtggagctttacaaaggtgtctgtgaactaggccactgggct
gagaaattcctaacggcctatttcgcctataaggatggggacatagactcttctcttatt
cagtatgcattgcttgccgaaatgggatatgaagtagctcaaagcaattcagcattcatt
ttggaatctaaaaaagctaaaattctggggaaagagaagttgtatccaatggcacttctg
ctatggaaccgagccgccattcaagggaacgcttttgctagagtaaaaattggagattac
cattactatggctacgggactaagaaggactacgaaacagcagccacacactacagcatc
gcagcagacaagcatcacagtgcacaagcaatgttcaacctggcatatatgtatgaacat
ggcttgggtattgcaaaggacattcacttggccagaagattgtacgacatggctgctcag
acaagcccagatgctcacatacctgtgttctttgcccttatgaaactggaaaccatgcat
ctgctccatgatatcctgttttttaattttaccatgaaatggaaatggctgaaactggac
agcactgttggaccatactgggatttattggtgattggcctaattgttgccatgctgatc
ttcctgcttagaaatcgccataggtag

DBGET integrated database retrieval system