KEGG   Mus musculus (mouse): 20344
Entry
20344             CDS       T01002                                 

Gene name
Selp, CD62, CD62P, GMP-140, Gr, Grmp, LECAM3, P-sel, PADGEM
Definition
(RefSeq) selectin, platelet
  KO
K06496  selectin, platelet
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04613  Neutrophil extracellular trap formation
mmu05144  Malaria
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    20344 (Selp)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    20344 (Selp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    20344 (Selp)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    20344 (Selp)
  09174 Infectious disease: parasitic
   05144 Malaria
    20344 (Selp)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    20344 (Selp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    20344 (Selp)
   04090 CD molecules [BR:mmu04090]
    20344 (Selp)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20344 (Selp)
   04091 Lectins [BR:mmu04091]
    20344 (Selp)
Cell adhesion molecules [BR:mmu04515]
 Selectins
  Selectin family
   20344 (Selp)
CD molecules [BR:mmu04090]
 Proteins
  20344 (Selp)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   20344 (Selp)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 4: Selectins
   20344 (Selp)
SSDB
Motif
Pfam: Sushi Lectin_C EGF EGF_2 EGF_3 hEGF EGF_CA
Other DBs
NCBI-GeneID: 20344
NCBI-ProteinID: NP_035477
MGI: 98280
Ensembl: ENSMUSG00000026580
Vega: OTTMUSG00000034812
UniProt: Q01102
Structure
PDB: 
4GXB

Position
1 H2.2; 1 71.42 cM
AA seq 768 aa
MAGCPKGSWTPRLRSVILGGAQLIWFSALISELVNQKEVAAWTYNYSTKAYSWNNSRVFC
RRHFTDLVAIQNKNEIAHLNDVIPFFNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADN
EPNNKKNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCSNQGECIETIGS
YTCSCYPGFYGPECEYVKECGKVNIPQHVLMNCSHPLGEFSFNSQCTFSCAEGYELDGPG
ELQCLASGIWTNNPPKCDAVQCQSLEAPPHGTMACMHPIAAFAYDSSCKFECQPGYRARG
SNTLHCTGSGQWSEPLPTCEAIACEPPEIPIHGSMDCVPSTGTFGYNSSCTFLCAEGFVL
KGNDAIQCADSGQWTAPAPFCEALQCPEFPVPSKAQVNCSDPFGTLTYQSVCSFSCDEGS
LLVGASVIRCLATGHWNGAPPECQAVSCAPMLSPENGSMTCVQPLGNSTYKSTCQFMCDE
GFYLSGPERLDCSPSGHWTGTPPTCEAIKCPGIFAPEQGNLDCSHVHGEFGVGSICHFSC
NEDFELLGSENVECTVSGRWSAPPPTCKGITSLPAPAVRCPALTTPGQGTMSCQHHLGSF
GPNTTCYFGCKTGFTLRGANSLRCRASGQWTAVTPMCRAVKCSELHMDTAVAMNCSNPWG
NFSYGSTCTFQCPEGQSLNGSVRATCREDGHWSDAMPTCQAGTLTIQEALTYLGGAVAST
TGLAVGGTLLALLRKRLRKKDDGKCPLNPHSHLGTYGVFTNAAYDPTP
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggctggctgcccaaaaggttcctggacgccaagactccggagtgtgatcctgggaggg
gctcaactcatctggttcagtgctttgatctctgagcttgtaaatcagaaggaagtggct
gcgtggacctataactacagcacaaaggcatactcatggaataactcacgggtgttctgt
aggaggcacttcacagacttagtggccatccagaataagaatgaaatcgctcacctcaat
gacgtcatcccattcttcaactcttactactggattggtatccgaaagatcaacaataag
tggacctgggtgggaacaaataagacactcacggaggaggctgagaactgggccgacaac
gagcccaacaacaagaagaacaatcaggactgtgtggagatctacatcaagagtaactcg
gcccctggcaagtggaatgatgaaccctgttttaaacgaaagcgggccctgtgctacaca
gcctcctgccaggacatgtcctgcagcaaccaaggggagtgcatcgagaccattgggagc
tatacctgctcctgctacccaggcttctatgggccagagtgtgaatacgtcaaggagtgt
ggaaaagtcaacatccctcaacatgttctcatgaactgcagccatcccctgggggagttc
tccttcaactcacagtgcaccttcagctgtgctgagggctacgagctggacggacccggc
gagctgcaatgtttggcttctgggatctggacaaataaccccccgaagtgtgacgctgtg
caatgtcagagcctggaagcccctccccatggaaccatggcctgtatgcacccaattgct
gcctttgcctacgactccagctgtaaatttgagtgccagcctggatatagagcgaggggc
tccaacacactccactgcactggctctggtcagtggagtgaaccactgccaacctgtgaa
gctattgcgtgtgaacctccggagatccccatccatgggagcatggactgcgtcccatct
acaggaacctttgggtacaacagcagctgcacttttctctgtgcagaggggttcgtgctg
aagggaaatgatgccattcagtgtgctgactccgggcagtggacagccccagccccattc
tgtgaagcgttgcaatgtccagagtttccggttcccagtaaagcccaggtgaactgctcg
gatcccttcggtaccttgacgtaccagtcagtctgcagcttttcctgtgatgaaggctcg
ctcttggtgggagcaagtgtgataagatgcctggctactggacactggaatggggctcct
cccgaatgtcaagctgtgtcctgtgcccctatgctcagtcctgagaatggatccatgacc
tgcgttcagcctcttgggaattccacctacaaatccacatgccagttcatgtgcgatgaa
ggattttatctatctggaccggaaagactggattgttctccatctggacactggacaggc
acccctcccacgtgtgaagccatcaagtgtccaggaatcttcgccccagagcaaggcaac
ctggattgttctcatgtccacggagagtttggtgttggctctatctgtcacttctcctgc
aatgaggactttgagctactgggatctgaaaatgtggaatgcacagtgtctggaagatgg
tcagcacctccgccaacctgcaaaggcataacatcacttcctgccccagcagtccgatgc
cctgccctcacgactcctggacagggcacaatgtcctgccaacaccacctgggaagcttt
ggtccgaacaccacttgttactttgggtgcaaaaccggatttacactcaggggagccaac
tcgctccgctgcagggcttcaggacaatggacagcagtgacccccatgtgcagagcggtc
aaatgctccgaattgcacatggacacagcagtagcaatgaactgttccaatccctgggga
aactttagctatggatcaacctgcaccttccagtgcccagaggggcagtcactgaacggc
tctgtgagagcaacctgccgagaggacggtcactggtcagatgccatgccaacctgccaa
gcagggacactgacaatccaggaagctctgacgtacttgggtggtgcagtggcttctaca
acaggcctggcagtgggcgggacactcctggctctgctaagaaagcgtctcagaaagaaa
gatgatggaaaatgccccttgaaccctcacagccacctaggaacatacggagtcttcact
aacgctgcatatgacccaaccccttaa

DBGET integrated database retrieval system