KEGG   Mus musculus (mouse): 20345
Entry
20345             CDS       T01002                                 

Gene name
Selplg, CD162, Ps, Psg, Psgl-1, Psgl1, Selp1, Selpl
Definition
(RefSeq) selectin, platelet (p-selectin) ligand
  KO
K06544  selectin P ligand
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04613  Neutrophil extracellular trap formation
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    20345 (Selplg)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    20345 (Selplg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    20345 (Selplg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    20345 (Selplg)
CD molecules [BR:mmu04090]
 Proteins
  20345 (Selplg)
SSDB
Motif
Pfam: DUF4689 Cadherin_C_2
Other DBs
NCBI-GeneID: 20345
NCBI-ProteinID: NP_033177
MGI: 106689
Ensembl: ENSMUSG00000048163
Vega: OTTMUSG00000055395
UniProt: Q3TA56
Position
5 F; 5 55.59 cM
AA seq 417 aa
MSPSFLVLLTILGPGNSLQLQDPWGHETKEAPGPVHLRERRQVVGDDDFEDPDYTYNTDP
PELLKNVTNTVAAHPELPTTVVMLERDSTSAGTSERATEKIATTDPTAPGTGGTAVGMLS
TDSATQWSLTSVETVQPASTEVETSQPAPMEAETSQPAPMEAETSQPAPMEAETSQPAPM
EADTSQPAPMEADTSKPAPTEAETSKPAPTEAETSQPAPNEAETSKPAPTEAETSKPAPT
EAETTQLPRIQAVKTLFTTSAATEVPSTEPTTMETASTESNESTIFLGPSVTHLPDSGLK
KGLIVTPGNSPAPTLPGSSDLIPVKQCLLIILILASLATIFLVCTVVLAVRLSRKTHMYP
VRNYSPTEMICISSLLPEGGDGAPVTANGGLPKVQDLKTEPSGDRDGDDLTLHSFLP
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtccccaagcttccttgtgctgctgaccatcttgggccctggcaacagccttcagctg
caggacccctgggggcatgaaaccaaggaagccccgggtcctgtgcatctccgggaacgg
aggcaggtggttggggatgacgattttgaggaccctgactatacgtataacacagacccc
ccagaattgctgaaaaatgtcaccaacaccgtggctgctcaccctgagctgccaaccacc
gtggtcatgctagagagagattccacgagcgctggaacctccgagagagccactgagaag
attgccaccactgaccctactgccccaggtacaggagggacagctgttgggatgctgagc
acagactctgccacacagtggagtctaacctcagtagagaccgtccaaccagcatccaca
gaggtagagacctcgcagccagcacccatggaggcagagacctcgcagccagcacccatg
gaggcagagacctcgcagccagcacccatggaggcagagacctcgcagccagcacccatg
gaggcagacacctcgcagccagcacccatggaggcagacacctcaaagccagcacccacg
gaggcagagacctcaaagccagcacccacggaggcagagacctctcagccagcacccaac
gaggcagagacctcaaaaccagcacccacggaggcagagacctcaaaaccagcacccacg
gaggcagagaccacccagcttcccaggattcaggctgtaaaaactctgtttacaacgtct
gcagccaccgaagtcccttccacagaacctaccaccatggagacggcgtccacagagtct
aacgagtctaccatcttccttgggccatccgtgactcacttacctgacagcggcctgaag
aaagggctgattgtgacccctgggaattcacctgccccaaccctgccagggagttcagat
ctcatcccggtgaagcaatgtctgctgattatcctcatcttggcttctctggccaccatc
ttcctcgtgtgcacagtggtgctggcggtccgtctgtcccgtaagacccacatgtaccca
gtgcggaactactcccccacggagatgatctgcatctcgtccctgctacctgagggggga
gacggggcccctgtcacagccaatgggggcctgcccaaggtccaggacctgaagacagag
cccagtggggaccgggatggggacgacctcaccctgcacagcttcctcccttag

DBGET integrated database retrieval system