KEGG   Mus musculus (mouse): 20346
Entry
20346             CDS       T01002                                 

Gene name
Sema3a, Hsema-I, SEMA1, SemD, Semad, coll-1
Definition
(RefSeq) sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
  KO
K06840  semaphorin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    20346 (Sema3a)
SSDB
Motif
Pfam: Sema ig V-set Ig_3 PSI Ig_2 Ig_6 I-set
Other DBs
NCBI-GeneID: 20346
NCBI-ProteinID: NP_001230001
MGI: 107558
Ensembl: ENSMUSG00000028883
Vega: OTTMUSG00000021298
UniProt: O08665
Structure
PDB: 
1Q47 4GZ8 4GZA

Position
5; 5 A1
AA seq 772 aa
MGWFTGIACLFWGVLLTARANYANGKNNVPRLKLSYKEMLESNNVITFNGLANSSSYHTF
LLDEERSRLYVGAKDHIFSFNLVNIKDFQKIVWPVSYTRRDECKWAGKDILKECANFIKV
LEAYNQTHLYACGTGAFHPICTYIEVGHHPEDNIFKLQDSHFENGRGKSPYDPKLLTASL
LIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPRFISAHLIPESDNPED
DKVYFFFRENAIDGEHSGKATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNG
IDTHFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRD
GPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPINNRP
IMIKTDVNYQFTQIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSVPKETWHDLEEVLLEEM
TVFREPTTISAMELSTKQQQLYIGSTAGVAQLPLHRCDIYGKACAECCLARDPYCAWDGS
SCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHDNHHGPSLEERIIYGVENSSTFLECSP
KSQRALVYWQFQRRNEDRKEEIRMGDHIIRTEQGLLLRSLQKKDSGNYLCHAVEHGFMQT
LLKVTLEVIDTEHLEELLHKDDDGDGSKIKEMSSSMTPSQKVWYRDFMQLINHPNLNTMD
EFCEQVWKRDRKQRRQRPGHSQGSSNKWKHMQESKKGRNRRTHEFERAPRSV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgggctggttcactgggattgcctgtcttttctggggtgtattacttacagccagagca
aactatgcaaacggaaagaacaatgtgccaagactgaaattatcgtacaaagaaatgttg
gaatccaacaatgtgatcacttttaatggcttggccaacagctccagttaccacaccttc
cttctggatgaagaacggagtagactatatgttggagcaaaagatcatatattttcattc
aacttggtgaacattaaagattttcaaaagattgtgtggccagtatcttacacaaggaga
gatgaatgcaaatgggctggaaaagatatcctgaaagaatgtgccaatttcatcaaggtc
ctggaggcttataatcagactcacttgtatgcctgtggaactggggctttccatccaatc
tgcacctatattgaagttggacatcatcctgaggacaacatttttaagctgcaggactca
cattttgaaaacggtcgtgggaagagcccttatgatcccaaactactgactgcctctctt
ctaatagacggtgagttgtactctggaactgctgcggacttcatgggacgggacttcgct
atcttcagaacactggggcaccatcaccccatcaggacggagcagcatgactcccggtgg
ctcaatgatcctagattcatcagtgcccatctcatcccagagagtgacaaccctgaagat
gacaaagtatattttttcttccgagaaaatgcaatagacggagaacactctggaaaagcc
actcatgctagaataggtcagatatgcaagaatgactttggtggacacagaagtcttgtg
aataaatggacaacattcctaaaagcacgcctgatttgctctgtgcccggtcccaatggc
attgacacccattttgatgaattgcaggatgtattcctaatgaactctaaagatcctaaa
aatccgatcgtctatggagtgttcacaacatcaagcaacatctttaagggatctgctgtg
tgcatgtacagcatgagtgatgtaagaagggtgttccttggtccatatgctcacagagat
ggtcccaactatcagtgggtgccttaccaaggaagagtcccttatccacggccaggaact
tgtcccagtaaaacatttggcggatttgactccacaaaggaccttcctgatgatgtcata
acttttgcaagaagtcatccagccatgtacaacccagtgtttcctataaataatcgcccg
atcatgatcaaaacagatgtaaattatcagttcacacaaattgttgtagaccgagtggat
gcagaagatggccagtatgatgttatgttcatcggaacagatgttggaaccgttcttaaa
gtggtttcagtccccaaggagacttggcatgacctagaagaagttcttctggaagaaatg
accgtcttccgggaaccaacaactatttcggcaatggagctttctactaaacagcaacag
ctgtacattggctcaactgcgggagtggcacagcttcctctacaccgctgtgacatctat
ggcaaagcctgtgcagaatgctgcctcgctcgggacccttactgtgcctgggatgggtcc
tcatgctcacgctattttcctactgcaaagaggcgcacaagacgacaagatataaggaat
ggagacccactgactcactgctctgacttgcagcaccatgataatcatcatgggcccagc
cttgaagagagaatcatctatggagtggaaaacagtagtacattcttggaatgcagtccg
aagtcacagagagccttggtatattggcaatttcagaggagaaatgaagatcgaaaagag
gagatcagaatgggtgatcatatcatcaggacagaacaagggctcctgctccgtagcctg
cagaagaaggattcaggcaattacctgtgtcacgctgtggaacacggattcatgcaaact
cttcttaaggtaaccctggaagtcattgacacagaacatttggaagaacttcttcataaa
gatgacgatggagatggctctaagataaaagaaatgtcgagcagcatgacgcccagccag
aaagtctggtaccgagacttcatgcagctcattaaccaccccaacctgaacacgatggat
gagttctgtgaacaagtgtggaaaagggaccgaaagcaacgccgacaaaggccggggcac
tctcaagggagcagcaacaagtggaagcacatgcaagagagcaagaaaggtagaaacagg
aggacccacgagtttgagcgggcacccagaagtgtctga

DBGET integrated database retrieval system